KEGG   Apis mellifera (honey bee): 410344Help
Entry
410344            CDS       T01057                                 

Gene name
CYLD
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    410344 (CYLD)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     410344 (CYLD)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C67
   410344 (CYLD)
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    410344 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 779 aa AA seqDB search
MEKCNSNNKEDRQVFQYFVAKQNTILMRISGECDKNVNTLRLGMLVEAIEDLGDSALKVR
VIDTTGSEIWRDTEWRCHRFDLISVSSEVWKFLPAVSVPQERVRLANYKHLCEELISLAI
NDTVWYCADPLGCTKFLAIIKYIGPVPQLGQGYYFGLDLLENQEPSKTALLSKEYFVSTH
SEGRFATLSNIFPLKPGGPTGLAKSDKNLCTKIETGNNYTNDKKKSVLDTIPPVLLERFS
LYDDNKNNNRDQGSLSKEYVQSIKSTTHENDSNLTKSNTLEKNENKKFGRTENLDLIVGS
NVKVLLDSDVHYGIIRWIGTPPGITSGKLIAAVELDDSHPSGTDGTFKDVRYFHCRPYKA
IFTDLEQCSRYDAMTKVDDSTTLINTDNFGNIESSVIVGMVRPISVKGNLESICGKYRGI
QGHHNSCYLDATLFSMFTFTSVFDNLLFRPPNEKDCPQYEEVQRVLREEIVNPLRKNMFV
RADRVMKLRTLLEKLSSVSGLTSEEKDPEEFLTSLVAQILNAEPFLKLSSGQDAYHYQLF
VEKDDHLNLPTVQQLLEQSFLTSNIRLKEVPSCLIIQMPRFGKSFKMYQKIQPTLLLDVT
DIIEDSPRQCTVCGKLAEYECKECFGQCGVGLESIAFCLQCLEKVHRHERRTNHEPKKLV
VPMEFAILQEHCPVPRLYLELSAVVCIETSHYVCFVKCGSGSEAPWCFFDSMADRKGEQN
GYNIPEMVPCPDFPYWLSEEGGNYLTELTDDRHLPEHAKRLLCDAYMCMYQSPDVMMYK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtgcaattctaacaataaggaagaccgtcaggtctttcaatattttgttgcc
aagcaaaatactattttaatgcgtatatcgggagaatgtgacaaaaatgttaatacatta
cgtcttggcatgttggttgaagctatcgaagatttaggagatagtgcgcttaaagtacgc
gttattgatacgacaggatcagaaatttggcgtgacacagaatggagatgtcatagattt
gatttaatctctgtttcatcagaagtatggaaatttttacctgctgtttcagtccctcaa
gaaagagttcgtttggcaaattataaacacttatgtgaggaacttataagcttagcaata
aatgatactgtttggtattgtgctgatcctctaggatgtactaaatttttggctattatt
aaatatattggacctgtgccacaacttggacaaggatattattttggccttgatttgttg
gaaaatcaagaaccatccaaaacagctttattaagcaaagaatattttgtttctactcat
tctgaaggaagatttgctacattaagtaatattttcccattaaaacctggaggtcctaca
ggtcttgcaaaatcagataaaaatttatgtacaaaaattgaaacaggaaataattataca
aatgataagaaaaaatctgtattggatactataccacctgttttgttagaaagatttagt
ctatatgatgataataaaaataacaatagagatcaaggatctttgtcaaaagaatatgtt
caatcaataaaatcaacaacacatgaaaatgacagcaatttaactaaaagtaatacactc
gaaaagaatgaaaataaaaaatttggaagaacagaaaatttggatctaattgtgggttca
aatgtaaaagttcttttggattctgatgtacattatgggattattcgttggattggaacc
cctcctggtattacttctggtaaattgattgcagctgttgaattggatgatagtcatcca
tcaggtactgatggaacatttaaagatgtaagatatttccattgtcggccatataaagct
atttttacagatctcgaacaatgttcacgatatgatgccatgacaaaagttgatgattca
acaacattgataaatacagataatttcggaaatatagaaagttccgttattgttggtatg
gtacgtcctatctctgtaaaaggaaacttggaaagtatttgtggaaaatatagaggaatt
caaggtcatcacaattcgtgttatttggatgccactctttttagcatgtttacatttact
agtgtttttgataatttattatttagaccaccaaatgaaaaagattgtccgcaatacgaa
gaagtacaaagagtattacgtgaagaaattgtaaatccacttagaaaaaatatgtttgta
agagcagatcgagtgatgaaactccgaactttacttgaaaaattatcatctgtatccgga
cttactagtgaagaaaaagatcctgaagaatttttaacttctttggttgcacaaattttg
aatgctgaaccatttcttaaattaagttctggtcaagatgcgtatcattatcaacttttt
gttgaaaaagatgatcatttaaatcttccaactgtgcaacaattattagaacaaagtttt
cttacaagtaacataagattgaaagaagttccttcatgtcttattatacaaatgccacga
tttggaaaatcatttaagatgtatcaaaaaattcaacctacattgttacttgatgtaaca
gacataattgaggattctccaagacaatgtactgtttgcggaaaattagcagaatacgaa
tgtaaagaatgttttggacaatgtggtgttggacttgaaagtattgcattttgtttgcaa
tgtttagaaaaggtacatcgacatgaacgaagaacaaatcatgaaccaaagaagcttgta
gtaccaatggaattcgctattttacaagaacattgtccagttccacgattgtatcttgaa
ttgtcggcagtagtttgtatcgaaacctcccattatgtatgttttgtaaaatgtggttct
ggctctgaagctccatggtgtttttttgattccatggcagatagaaaaggagaacaaaac
ggttacaatataccggaaatggttccatgtccggattttccatattggttaagcgaagaa
ggtggaaattatttaactgaattaacagacgatcgtcatctacctgaacatgcaaaacga
ctgttatgtgatgcatatatgtgcatgtatcaatctccagatgttatgatgtacaaataa

DBGET integrated database retrieval system