KEGG   Apis mellifera (honey bee): 410344Help
Entry
410344            CDS       T01057                                 

Gene name
CYLD, GB19483
Definition
cylindromatosis
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     410344 (CYLD)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C67
   410344 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 779 aa AA seqDB search
MEKCNSNNKEDRQVFQYFVAKQNTILMRISGECDKNVNTLRLGMLVEAIEDLGDSALKVR
VIDTTGSEIWRDTEWRCHRFDLISVSSEVWKFLPAVSVPQERVRLANYKHLCEELISLAI
NDTVWYCADPLGCTKFLAIIKYIGPVPQLGQGYYFGLDLLENQEPSKTALLSKEYFVSTH
SEGRFATLSNIFPLKPGGPTGLAKSDKNLCTKIETGNNYTNDKKKSVLDTIPPVLLERFS
LYDDNKNNNRDQGSLSKEYVQSIKSTTHENDSNLTKSNTLEKNENKKFGRTENLDLIVGS
NVKVLLDSDVHYGIIRWIGTPPGITSGKLIAAVELDDSHPSGTDGTFKDVRYFHCRPYKA
IFTDLEQCSRYDAMTKVDDSTTLINTDNFGNIESSVIVGMVRPISVKGNLESICGKYRGI
QGHHNSCYLDATLFSMFTFTSVFDNLLFRPPNEKDCPQYEEVQRVLREEIVNPLRKNMFV
RADRVMKLRTLLEKLSSVSGLTSEEKDPEEFLTSLVAQILNAEPFLKLSSGQDAYHYQLF
VEKDDHLNLPTVQQLLEQSFLTSNIRLKEVPSCLIIQMPRFGKSFKMYQKIQPTLLLDVT
DIIEDSPRQCTVCGKLAEYECKECFGQCGVGLESIAFCLQCLEKVHRHERRTNHEPKKLV
VPMEFAILQEHCPVPRLYLELSAVVCIETSHYVCFVKCGSGSEAPWCFFDSMADRKGEQN
GYNIPEMVPCPDFPYWLSEEGGNYLTELTDDRHLPEHAKRLLCDAYMCMYQSPDVMMYK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtgcaattctaacaataaggaagaccgtcaggtctttcaatattttgttgcc
aagcaaaatactattttaatgcgtatatcgggagaatgtgacaaaaatgttaatacatta
cgtcttggcatgttggttgaagctatcgaagatttaggagatagtgcgcttaaagtacgc
gttattgatacgacaggatcagaaatttggcgtgacacagaatggagatgtcatagattt
gatttaatctctgtttcatcagaagtatggaaatttttacctgctgtttcagtccctcaa
gaaagagttcgtttggcaaattataaacacttatgtgaggaacttataagcttagcaata
aatgatactgtttggtattgtgctgatcctctaggatgtactaaatttttggctattatt
aaatatattggacctgtgccacaacttggacaaggatattattttggccttgatttgttg
gaaaatcaagaaccatccaaaacagctttattaagcaaagaatattttgtttctactcat
tctgaaggaagatttgctacattaagtaatattttcccattaaaacctggaggtcctaca
ggtcttgcaaaatcagataaaaatttatgtacaaaaattgaaacaggaaataattataca
aatgataagaaaaaatctgtattggatactataccacctgttttgttagaaagatttagt
ctatatgatgataataaaaataacaatagagatcaaggatctttgtcaaaagaatatgtt
caatcaataaaatcaacaacacatgaaaatgacagcaatttaactaaaagtaatacactc
gaaaagaatgaaaataaaaaatttggaagaacagaaaatttggatctaattgtgggttca
aatgtaaaagttcttttggattctgatgtacattatgggattattcgttggattggaacc
cctcctggtattacttctggtaaattgattgcagctgttgaattggatgatagtcatcca
tcaggtactgatggaacatttaaagatgtaagatatttccattgtcggccatataaagct
atttttacagatctcgaacaatgttcacgatatgatgccatgacaaaagttgatgattca
acaacattgataaatacagataatttcggaaatatagaaagttccgttattgttggtatg
gtacgtcctatctctgtaaaaggaaacttggaaagtatttgtggaaaatatagaggaatt
caaggtcatcacaattcgtgttatttggatgccactctttttagcatgtttacatttact
agtgtttttgataatttattatttagaccaccaaatgaaaaagattgtccgcaatacgaa
gaagtacaaagagtattacgtgaagaaattgtaaatccacttagaaaaaatatgtttgta
agagcagatcgagtgatgaaactccgaactttacttgaaaaattatcatctgtatccgga
cttactagtgaagaaaaagatcctgaagaatttttaacttctttggttgcacaaattttg
aatgctgaaccatttcttaaattaagttctggtcaagatgcgtatcattatcaacttttt
gttgaaaaagatgatcatttaaatcttccaactgtgcaacaattattagaacaaagtttt
cttacaagtaacataagattgaaagaagttccttcatgtcttattatacaaatgccacga
tttggaaaatcatttaagatgtatcaaaaaattcaacctacattgttacttgatgtaaca
gacataattgaggattctccaagacaatgtactgtttgcggaaaattagcagaatacgaa
tgtaaagaatgttttggacaatgtggtgttggacttgaaagtattgcattttgtttgcaa
tgtttagaaaaggtacatcgacatgaacgaagaacaaatcatgaaccaaagaagcttgta
gtaccaatggaattcgctattttacaagaacattgtccagttccacgattgtatcttgaa
ttgtcggcagtagtttgtatcgaaacctcccattatgtatgttttgtaaaatgtggttct
ggctctgaagctccatggtgtttttttgattccatggcagatagaaaaggagaacaaaac
ggttacaatataccggaaatggttccatgtccggattttccatattggttaagcgaagaa
ggtggaaattatttaactgaattaacagacgatcgtcatctacctgaacatgcaaaacga
ctgttatgtgatgcatatatgtgcatgtatcaatctccagatgttatgatgtacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system