KEGG   Apis mellifera (honey bee): 410422Help
Entry
410422            CDS       T01057                                 

Gene name
Dhfr, GB12274
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    410422 (Dhfr)
   00670 One carbon pool by folate
    410422 (Dhfr)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     410422 (Dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG13
AA seq 158 aa AA seqDB search
METQYRSELAFFTYMTTNTKNPNKRNVVLMGRRTWESIPKENRPLKNRINIVLTSQSLDY
GNDVIVCKNIPHAFEVIEKIKDRIENIWVTGGSSVYKEAMESPNFYRLYLTRIKKYFECD
TFFPTIPNDFVLTEDPNIPQGIQEENDIQFVYEVYKKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcaatatagaagtgaattggcattttttacatatatgactacgaatacgaaa
aacccaaacaaaagaaatgttgtattgatgggacgtagaacatgggaatctattccaaaa
gaaaataggcctttgaaaaatcgaataaatattgttttaacatcacaatctttggattat
ggaaatgatgtgattgtatgtaaaaatattccacatgcttttgaagttattgaaaaaatt
aaagatcgaattgaaaatatatgggtaacaggaggaagttccgtttacaaggaagcaatg
gaatctccaaatttttaccgattatatttgactagaataaaaaaatattttgagtgtgat
acattttttccaactatccctaatgatttcgttttaacagaagatccaaacataccacaa
ggaattcaagaagaaaatgatatacaattcgtatatgaagtatataaaaaagaatag

DBGET integrated database retrieval system