KEGG   Apis mellifera (honey bee): 410422Help
Entry
410422            CDS       T01057                                 

Gene name
Dhfr, GB12274
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ame00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ame00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 158 aa AA seqDB search
METQYRSELAFFTYMTTNTKNPNKRNVVLMGRRTWESIPKENRPLKNRINIVLTSQSLDY
GNDVIVCKNIPHAFEVIEKIKDRIENIWVTGGSSVYKEAMESPNFYRLYLTRIKKYFECD
TFFPTIPNDFVLTEDPNIPQGIQEENDIQFVYEVYKKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcaatatagaagtgaattggcattttttacatatatgactacgaatacgaaa
aacccaaacaaaagaaatgttgtattgatgggacgtagaacatgggaatctattccaaaa
gaaaataggcctttgaaaaatcgaataaatattgttttaacatcacaatctttggattat
ggaaatgatgtgattgtatgtaaaaatattccacatgcttttgaagttattgaaaaaatt
aaagatcgaattgaaaatatatgggtaacaggaggaagttccgtttacaaggaagcaatg
gaatctccaaatttttaccgattatatttgactagaataaaaaaatattttgagtgtgat
acattttttccaactatccctaatgatttcgttttaacagaagatccaaacataccacaa
ggaattcaagaagaaaatgatatacaattcgtatatgaagtatataaaaaagaatag

DBGET integrated database retrieval system