KEGG   Apis mellifera (honey bee): 410424Help
Entry
410424            CDS       T01057                                 

Gene name
Pdk, GB12360
Definition
pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 416 aa AA seqDB search
MKLTQKCLGNISKMLDFYSQFNPSPLSIKQFIDFGLSACERKSFIFLRKELPVRLANIMK
EIHLLPENLLKMPSVGIVNNLYATSFEDIMQFEKVEVNDSTLDKFCQTLVKIRNRHKDIV
ETMAQGVLELKESHDVDVQTENNIQYFLDRFLMSRISIRMLINQHTLLFGSELNGHSRHV
GSIDPSCEISCVVKDAYEKARLLCDQYYMASPELIVQQHNEYDRCSQIRIVYVPSHLFHM
LFELFKNSMRAVMEHHSSNGEYPAIEVIVSRGKEDICVKMSDKGGGIPRSQMDHLFKYMY
STAPRPTKTDAHTVPLAGYGYGLPVSRLYARYFHGDLVLQSCDGFGTDAIVYLKALSNEA
NELLPIFNKTSSKFYRTQVSTTDWSSHCGGGMATRQLRMSHVQGHKLPRGMEVRHC
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcacacaaaagtgtcttgggaatatcagcaagatgttggacttttattcgcaa
ttcaatccttcgccgctttcgataaaacagttcatcgatttcggcctaagtgcctgtgag
aggaaatcctttatattcttaaggaaggagttgccggtccgattggccaacattatgaaa
gagatccatctattgccggagaatttattgaaaatgcctagcgtgggtatagttaataat
ttatacgccacctcgttcgaggatatcatgcagttcgagaaggttgaagtcaacgatagc
actctagacaaattctgtcaaacattggtgaaaattaggaacaggcataaggacatcgtg
gaaacgatggcgcagggtgtattagaattgaaagaatcccacgatgtcgatgtccaaacg
gaaaacaatattcaatatttcttggacagatttctcatgtcccgaatttccattcgtatg
ctgatcaatcaacatactctcttgttcggtagcgaattaaacggacacagtagacacgtg
ggatccatagatccatcctgcgagataagctgcgttgtgaaagacgcgtatgagaaagcg
agattactgtgtgatcaatattatatggctagtccggaattgatagtccagcaacataac
gagtacgatcgatgtagccaaattagaatagtttacgtaccgagccatttgttccacatg
ctgttcgaacttttcaaaaacagtatgcgagcggttatggaacaccatagctcgaacggg
gaatatccagcgatagaggtgatcgtgtcgcgtggaaaggaagatatatgcgttaagatg
tccgataaaggcggtggtattcctcgctcgcaaatggaccatttgtttaaatacatgtac
agcacggcgcctaggccgaccaaaaccgatgcccacacagtcccacttgccggttacggt
tacggtcttccagtatctcgattatacgccagatatttccacggtgatctcgttctccaa
agttgcgatggtttcggtaccgatgcaatcgtatatctaaaggcattgtcgaacgaggcc
aacgagttattgccaattttcaacaagacttcctccaaattttatcgaactcaagtatca
accaccgattggagcagtcattgcggcggtggaatggctacgaggcaattacgtatgagt
catgtccaaggacacaaacttccacgtggaatggaagttaggcattgttaa

DBGET integrated database retrieval system