KEGG   Apis mellifera (honey bee): 410459Help
Entry
410459            CDS       T01057                                 

Gene name
CycH, GB12261
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
ame  Apis mellifera (honey bee)
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ame03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ame03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG13
AA seq 331 aa AA seqDB search
MFPQSSQSRYWIFSDENDLTALREKTNAEFIQKHGANMTSGEREEHFLSHTEERILLRFY
ELQLRDFCRRFTPSMPRATIATALHYFKRFYLRNSVMDYHPKEILVTCVYLACKVEEFNV
SIYQFVANIKGDREKASDIILNNELLLMQQLNYNLTVHNPFRPVEGLMIDIKTRYTSLEN
PERLRPYIDEFLERVFLTDSVLLYTPSQVALAATLHAASRASANLDNYVTDILFSKEHLG
CIIEAVRKIRSMAKCVDPPSREMVRALEKKLEKCRNQENNPDSEIYKQRMQEMLDEEDLQ
DNEKYAKIIQDQAAHDEKILGVSKVLSPSAL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttccacaaagttcacagagtaggtactggatatttagtgatgaaaatgatttgaca
gcgttgagagagaaaaccaacgcagaatttattcaaaaacatggtgcaaacatgacgtca
ggggaaagggaagaacattttctttcccatacggaagaacgtatattacttcgtttttat
gaattacaattaagagatttctgtcgtcgttttactccttcaatgccacgtgctactata
gcaactgcattacattatttcaaaagattctatctcagaaacagcgttatggattatcat
cccaaagagattttagtcacatgtgtctatttggcctgtaaagtagaagaatttaatgtc
tccatatatcaatttgttgcaaatattaaaggagatagagaaaaagcatctgatattata
cttaataatgaattacttcttatgcaacagttaaattataatttgacagtacataatcca
ttcaggccagtagaaggtttaatgatagatatcaagacaaggtatacctctttggaaaat
ccagaaaggttaaggccatatatcgatgaatttttagaaagagtatttttgactgatagc
gttttattatatactccaagccaagttgcattggctgcaacattacatgctgcatccaga
gcatctgctaatttagataattatgtgactgatattttgttctctaaagaacatttggga
tgtataatagaagcagtaagaaaaataagatcaatggctaaatgtgtagatcctccttca
agagaaatggtaagagctttagaaaaaaaattagaaaaatgtagaaatcaggaaaataat
cctgatagtgaaatctataaacaaagaatgcaagaaatgttggacgaagaagatttacag
gacaatgagaaatatgctaaaattatacaggatcaagcagctcacgatgagaaaattttg
ggcgtcagtaaagttttgtctccttcagctctgtaa

DBGET integrated database retrieval system