KEGG   Apis mellifera (honey bee): 410530Help
Entry
410530            CDS       T01057                                 

Gene name
GB13388
Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    410530 (GB13388)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     410530 (GB13388)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   410530 (GB13388)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG14
AA seq 534 aa AA seqDB search
MLKTKFTVLYISFSLVGIVVATLKEDIQYWRELANEELEEALSYKWNTNKAKNVIVFVGD
GMSPDTITASRIYRAGENSRLAWENFPHIGILKTYNTNKQVPDSASTATALFGGVKTNFD
LVGLDANVELNNCSKSLKTDYHVDSIISWAQTTGKDTGFVTTTRVTHATPAPLYAHSANR
RWECESKMPKTAEKCKDIARQLVEDLPGRNIKVIMGGGRQMLKTNATGTEYDPIDEWAGH
RQDGKDLIEEWKRDKSSRGLAFSVVQNNEELSRVNIDKIDYLLGIFANGHISMDWNRKKG
PKGQPSLEDMTVTALKILQKSKYGYLLVVEGGLIDFAHHRGHAAQALLETVRFSDAINAT
LKMINTQDTLVIVTSDHTHSMSFNGYSDRGSHILGIAQKSKIDGIPYTTLSYSTGGPNNM
AYTVNNSNSVRIDPSKENTTEFTYSQQATIISDEAYHGGGDVAVYAIGPYAHLFHSVHEQ
SYVALVIAHAMKLKSNMKLKSDMKLKSENNAGKHYSNIINVFIYCCLFLLVLFH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaactaaattcaccgtgttatacatcagcttttctcttgttggaattgttgtt
gccacattgaaagaagatattcaatattggcgggaattggctaatgaagaattggaggaa
gctttatcgtacaaatggaatacgaacaaagcgaagaacgtgatcgtctttgtaggcgat
ggcatgagtcctgacaccataaccgccagtagaatataccgtgctggcgagaacagtcgt
ttggcttgggaaaattttcctcacataggcattcttaagacgtataatactaacaagcaa
gtaccagattcagcttcaacggcaactgctttgtttggtggagtgaaaacaaatttcgat
ttggttggactggatgcaaatgtagagctaaacaattgctctaagagtttgaaaacagat
tatcatgtggattctattatttcatgggcgcagactactggtaaagacacaggatttgtg
acgactaccagggtgacccatgcaactccagcacctttgtatgcgcatagcgcgaacaga
cgatgggaatgcgagtcgaaaatgccgaagactgctgaaaaatgcaaagacatcgccaga
caattggtggaagatctgccaggaagaaatatcaaggtaattatgggaggtggtagacaa
atgctcaagactaatgctacaggtactgaatatgatcctatagacgagtgggctggtcac
agacaggatggtaaagatttaatcgaggaatggaaacgagacaaatcctctagaggattg
gccttcagtgttgttcaaaataacgaagaattatctcgcgtaaacattgataaaatcgat
tacttgttaggaatttttgcaaatggtcatattagtatggactggaacagaaaaaaaggt
cccaaagggcaaccgagtctcgaagacatgactgtgacggcattgaaaattttacagaaa
tcaaaatatggttatcttctcgtggttgagggaggacttattgattttgctcatcatcgt
ggtcacgctgcacaagcattattagaaaccgttaggttttcggacgccattaatgcaact
ttgaagatgatcaatacgcaagacacacttgttatcgtaaccagtgatcacacgcattcg
atgagctttaatggatatagcgatagaggttcacacattctaggcatagctcagaaatct
aaaatcgacggaatcccatatactacgttgagttatagcacaggtggaccgaataatatg
gcgtatacagttaataattctaattctgttaggatagatccttctaaagaaaatactaca
gaattcacgtatagtcaacaggcaactattatatcggatgaagcttatcatggtggcggt
gacgtagctgtctatgctataggtccgtatgctcacttatttcatagtgtacacgaacaa
agctatgttgcacttgtgattgcacacgctatgaaattgaagtctaatatgaaattaaag
tcggatatgaaattaaagtctgaaaacaacgctggaaaacactatagtaatataattaat
gttttcatatattgttgcttgtttcttttagtgttatttcattga

DBGET integrated database retrieval system