KEGG   Apis mellifera (honey bee): 410575Help
Entry
410575            CDS       T01057                                 

Gene name
Mkk4, GB13132, MAPKK4
Definition
MAP kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     410575 (Mkk4)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   410575 (Mkk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 436 aa AA seqDB search
MTENRGNFSTPTTQSSSRQFNFQHLDFTSINDVQNEMSEKRRQFKLNFQTQGSNIPLNNS
TNTSLSNSTGTAACLPISSRPNLPLSLPKLPVRSCTAVPQELPDKARDKLRMCQSMQSTG
KLQLSPNAVYDFTSEDLQDLGEIGRGGFGTVNKMIHRISDTVMAVKRIRSTVDEREQKQL
LMDLEVVMKSNECPCIVQFYGALFKEGDCWICMELMDTSLDIFYKFIHEVLKERIPERIL
GKITVATVKALNYLKEKLRIIHRDVKPSNILLDRHGNIKLCDFGISGQLVDSIARTRDAG
CRPYMAPERIDPQRAKGYDVRSDVWSLGITLMEIATGYFPYPKWNSVFEQLYQVVQGDPP
RLSPNENGNHFTMDFVNFVNTCLIKEETQRPKYNKLLEHPFIRKAEEDTVDVSAYISGVL
DNMVLRGLTPFTTNRH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaatcgaggaaatttttcaacaccaactactcaaagttctagtagacaattt
aatttccaacatttggattttacatctattaatgatgttcaaaatgaaatgtcagaaaaa
agaagacaatttaaacttaattttcaaacacaaggaagtaatataccacttaataattca
acgaatacttctctttctaattcaactggaactgcagcctgtttaccaatatcttctcgt
ccaaatttgcctttatctttgcctaaactaccagtaagatcttgtactgcagttccacaa
gaattacccgataaagcaagggataaattacgaatgtgtcaatcaatgcaaagtactgga
aaattacagctatcaccaaatgcagtatatgattttacaagtgaagatcttcaagattta
ggagaaataggacgaggaggatttggcactgtaaataaaatgattcataggataagtgat
actgttatggctgtgaagagaattcgttctacagtggatgaaagggagcaaaaacaatta
ttaatggatttagaagttgtaatgaaatctaatgaatgtccatgcattgtacaattttat
ggagctttattcaaagaaggtgactgttggatttgcatggaacttatggatacttcatta
gatatattttataaatttattcatgaggtattaaaagaaagaataccagaacgtatttta
ggaaaaattactgttgccacagtaaaggcgttgaattacctcaaggaaaaattaagaata
attcatagagatgtaaaacctagtaatattctattagatcgacatggtaatataaaactt
tgtgattttggtatatcagggcaattggtagattcaattgcacgaactcgcgatgctgga
tgtaggccatatatggctccagaaaggatagatcctcaacgtgcaaagggttatgatgtt
agaagcgatgtatggtcattaggaattacattaatggaaattgcaactggttattttcca
tatccaaaatggaattcagtttttgagcaactttatcaagtagttcaaggtgatccacca
cgtttatctcctaatgaaaatgggaatcattttacaatggattttgtgaattttgtgaat
acatgtttaatcaaggaagagacacaacggccgaaatacaataaattattagaacatcct
tttatcagaaaagcagaagaagacactgttgatgtttcagcttatataagtggtgttctc
gataacatggttctcaggggattgacgccttttactactaatcggcattaa

DBGET integrated database retrieval system