KEGG   Apis mellifera (honey bee): 410757Help
Entry
410757            CDS       T01057                                 

Gene name
Clk, GB17107
Definition
clock
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    410757 (Clk)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     410757 (Clk)
Transcription factors [BR:ame03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    410757 (Clk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 724 aa AA seqDB search
MASYSRGRSSRQSDDTMDDDIDDKDDSKRKSRNLSEKKRRDQFNMLVNELGSMVSSNTRK
MDKSTVLKSTILFLKNHNEIAVRSRVHEIQEDWKPSFLSNEEFTHLILEALDGFIMVFSS
SGRIYYVSESVTSLLGYLPNELENTTVYDITYQEDQSPLYNVLLNPAITKDRRNIREEDK
ISFSCHIKRGGQNIEENPIYELVQFVGYFRSDVDTEVDNLLPNTKFGNTTGKDTKLVFVG
TGRLQTPQLIRELSVLDNTKSEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYY
HVDDLDKVVTCHESLMQKGEGTSCYYRFLTKGQQWIWLQTRFYITYNQWNSKPEFIVCTH
YVVSYIDVIKELRKESQSFNKEQTQDVIMSVKQEQVTTSCPVPPTQWSTKSSKTSKSIPS
NTRPRHHVESSDSSSISASMQSSPHSQITHISRSKGTSANSSVASKTQMLQIDTRHQQQQ
QQQSQQSLLEVDQSCINFMEHSQYAGVNLQSVNTDFETPSVPIISSLPTQEMLHQQNIVM
TPAQNQIQDELQRKHEELQQLIMHQQEELRKVSEQLLKYGILSLNTGMPYNATNTCQQIN
RCNTTNSNVQLPTSSSVHGVNVLPLPITVPMPIVPIEFFSHSLAVSPVPTMSDQAQGNVD
TMIQPQQQSHQQLQHQQQQSQQQGPTQQNGNQSDLVPFQMCPHQADMLYNEMESASNQQR
SSQN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttattcacgagggcgatcctctcgacaatccgatgacacaatggacgatgat
attgatgataaagatgactcgaagcggaaatcacgtaatttgagcgagaagaaacgaaga
gatcaatttaatatgctcgtaaatgagcttggtagtatggtcagttcgaatacaagaaaa
atggacaaatcgacagtgttaaagtcgacaatattatttttaaaaaatcataatgagata
gctgttagatcaagagtacatgaaattcaagaagattggaaaccatcttttctatcaaac
gaggaattcacacatttaatactagaggctctggacggttttataatggtattttcttca
agcgggcgcatttattatgtgtctgaaagcgtcacatctcttcttggatatcttccaaac
gagttggaaaatacgaccgtttacgatatcacgtatcaagaagatcaatctcctctttat
aatgtactattaaatcctgccatcacaaaagatcgacggaatatcagagaagaggacaaa
atatctttttcgtgtcacattaaaagaggaggtcaaaatattgaagagaacccaatatac
gagcttgtgcaatttgtcggatattttcggtctgatgtcgatacagaagtggataatctg
cttcctaatacaaaattcggaaatactactggaaaagatacaaaattggttttcgtgggt
acaggacgtctccagacacctcaattgatccgcgaattatccgtgttggacaatacgaaa
tcggaattcacctcacgtcatagcctcgaatggaaattcttgtttctggatcatcgagca
ccacccattatcggttacttaccatttgaggtattaggtacctctggatacgattattat
cacgtagatgatttggacaaagtagttacatgtcatgaatcattaatgcaaaagggtgag
ggaacctcctgttattatagattccttacgaaaggacaacaatggatatggttgcagact
agattctatattacgtataatcaatggaactcaaagcctgaatttatcgtgtgcacgcat
tatgtcgtcagttatatcgatgtgatcaaagaattgcgcaaagaatcgcagagttttaat
aaagaacagactcaagacgttataatgtcggtaaaacaagaacaggtaacgacatcatgc
ccagtccctccaacacagtggtcaacaaaatcatccaagacatcgaaatcaataccatca
aacactcgaccgagacaccatgtcgaaagctctgacagttcgtcaatatcagcctctatg
caaagttcaccccattcacagataacgcatatttcacgttcaaaaggtacatctgcaaac
agttctgttgcatcgaagactcaaatgcttcaaatagatactaggcatcaacagcaacaa
caacaacaatctcaacaatctttgttggaagtggatcaaagttgtattaatttcatggaa
cattcacagtatgcgggagttaatttgcaatccgtcaacacagattttgagactccttcc
gtgccaattatatcttcattaccaacgcaagagatgttacatcagcaaaatatcgtaatg
acaccagcgcagaatcaaattcaagacgaattgcaacgaaaacatgaagaattgcaacaa
ttaataatgcatcagcaagaagaactgagaaaagtatcggaacagttgcttaaatatgga
attttatcactcaatacgggaatgccatacaatgccaccaacacgtgtcaacaaataaac
agatgcaatacaaccaattcgaacgttcaattaccaacatcaagtagtgttcatggagtg
aacgttcttcctcttcccatcaccgttccaatgcctatagtgcctatagaattcttttca
cattcgttagcagtgagtccagtgccaacaatgtctgatcaagctcaaggtaacgtagac
acgatgattcagcctcaacaacaatcacatcaacaactgcaacatcagcagcaacaatcc
caacaacaaggaccaactcaacagaatggcaaccagtctgatctcgtgccttttcagatg
tgtccgcatcaagcggacatgttgtataacgagatggaatcagcttcgaatcaacaaaga
tcatcgcagaattaa

DBGET integrated database retrieval system