KEGG   Apis mellifera (honey bee): 410956Help
Entry
410956            CDS       T01057                                 

Gene name
nmo
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    410956 (nmo)
   04068 FoxO signaling pathway
    410956 (nmo)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     410956 (nmo)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   410956 (nmo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 528 aa AA seqDB search
MAVVGPSRHSRVSMSVSMSLMQGGGAGATGGGGTTGAHPGQAVLAAAAQAPPTYYHPTAP
APPPPPPAQDLVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFREL
KMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSPDHIKVFLY
QILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQNKHMTQEVVTQYY
RAPEILMGARHYTAAVDVWSVGCIFGELLRRRILFQAQSPVQQLELITELLGTPTLEDMR
FACEGARSHMLRRAPKPPSLTALYTLSSQATHEAVHLLCQMLVFDPDKRITVVDALAHPY
LDEGRLRYHSCMCTCCYTTSGGLRQYTGDFEPATSHPFDDLWERKLTTVQQVKEEMHKFI
AEQLNTSRVPLCINPQSAAFKSFARFIEELPVWSFDQSIPHPVHTSLIVRISLPLPSNFL
ELPLSSIIVENRWERARCRDHQEIVDRRSSILNIDIESVRLVIKAGYL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagttgggcccagccgacactcgcgagtgtccatgagcgtgtctatgtcgcta
atgcaggggggtggggcgggagcgacaggcggtggcgggacaacgggggcccacccggga
caagcggtcctcgcggcggcggcccaggcaccccccacctactaccaccctaccgctcct
gcgcccccgccaccgccgccagcccaggatctcgttcagcccgacagacccatcggatat
ggtgccttcggcgtcgtctgggcagtgacagatccgagggatggtaggagagtggccttg
aaaaaactgccgaatgtctttcagagcctcgtgagcagcaaacgagtcttcagggagttg
aagatgctctgtttcttcaaacacgaaaacgttctctcggccctggacatccttcaacca
cctcatctggacttcttccaagaaatatatgtgatcacggagctgcttcagagcgatttg
cacaagattatcgtcagccctcagcatctaagtcccgaccacatcaaggtcttcctgtat
caaattctcagaggcctcaagtaccttcactcagccagaatcttgcacagggatattaag
ccgggcaatttactcgtgaacagcaattgcgtgctgaagatctgcgacttcggtttggcc
cgagtggaagaaccggatcagaacaagcacatgacccaggaagtggtgacgcagtattat
cgcgcgccggagatcctaatgggggcgcgacactacacggccgcagtggacgtttggagc
gtcggttgcatattcggcgaacttcttcgtcgaaggatccttttccaggcacagagccct
gtgcaacagctggaactgatcacagaattgctgggcacgccaaccctcgaggacatgagg
ttcgcgtgcgagggtgcgagatcccacatgctgaggcgcgcgccgaagccaccctcgttg
acggcactctacacccttagcagccaggcgacgcacgaggccgtccatttgctctgccag
atgctagtcttcgatcctgacaagaggatcacggtggtggatgcactggcgcatccctat
ctggacgaagggagactgagatatcactcgtgcatgtgcacgtgctgttacacgaccagc
ggcggtttgagacagtacacgggtgatttcgagccggccacgtcgcatccgttcgacgat
ctttgggaacggaagctcaccactgtgcagcaggtgaaagaggaaatgcacaaatttata
gcggaacagctgaacacgtcgcgcgtgccgctctgcataaatccgcagtccgcggcgttc
aagagctttgcaagatttatagaagaattacctgtatggagtttcgatcaatcgatccca
catcccgtgcacacgtcattaattgtacgtatttctcttcctcttcccagcaacttcctc
gaacttcctctctcatcgatcatagtggaaaatcgttgggaaagagctcggtgcagggat
caccaggagatcgtcgatcgtcgatcctcgattctgaatatcgatattgaaagtgtccgc
cttgtgataaaggcgggctatctgtaa

DBGET integrated database retrieval system