KEGG   Apis mellifera (honey bee): 410956Help
Entry
410956            CDS       T01057                                 

Gene name
nmo, GB12339
Definition
nemo
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:ame04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ame04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 341 aa AA seqDB search
MLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSPDHIKVFLYQ
ILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQNKHMTQEVVTQYYR
APEILMGARHYTAAVDVWSVGCIFGELLRRRILFQAQSPVQQLELITELLGTPTLEDMRF
ACEGARSHMLRRAPKPPSLTALYTLSSQATHEAVHLLCQMLVFDPDKRITVVDALAHPYL
DEGRLRYHSCMCTCCYTTSGGLRQYTGDFEPATSHPFDDLWERKLTTVQQVKEEMHKFIA
EQLNTSRVPLCINPQSAAFKSFASSTVAHPSELPPSPHQWE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtttcttcaaacacgaaaacgttctctcggccctggacatccttcaaccacct
catctggacttcttccaagaaatatatgtgatcacggagctgcttcagagcgatttgcac
aagattatcgtcagccctcagcatctaagtcccgaccacatcaaggtcttcctgtatcaa
attctcagaggcctcaagtaccttcactcagccagaatcttgcacagggatattaagccg
ggcaatttactcgtgaacagcaattgcgtgctgaagatctgcgacttcggtttggcccga
gtggaagaaccggatcagaacaagcacatgacccaggaagtggtgacgcagtattatcgc
gcgccggagatcctaatgggggcgcgacactacacggccgcagtggacgtttggagcgtc
ggttgcatattcggcgaacttcttcgtcgaaggatccttttccaggcacagagccctgtg
caacagctggaactgatcacagaattgctgggcacgccaaccctcgaggacatgaggttc
gcgtgcgagggtgcgagatcccacatgctgaggcgcgcgccgaagccaccctcgttgacg
gcactctacacccttagcagccaggcgacgcacgaggccgtccatttgctctgccagatg
ctagtcttcgatcctgacaagaggatcacggtggtggatgcactggcgcatccctatctg
gacgaagggagactgagatatcactcgtgcatgtgcacgtgctgttacacgaccagcggc
ggtttgagacagtacacgggtgatttcgagccggccacgtcgcatccgttcgacgatctt
tgggaacggaagctcaccactgtgcagcaggtgaaagaggaaatgcacaaatttatagcg
gaacagctgaacacgtcgcgcgtgccgctctgcataaatccgcagtccgcggcgttcaag
agctttgcaagctccacagtggctcatccttcggaactgccaccctctcctcaccagtgg
gaataa

DBGET integrated database retrieval system