KEGG   Apis mellifera (honey bee): 411021Help
Entry
411021            CDS       T01057                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B18
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    411021
   00053 Ascorbate and aldarate metabolism
    411021
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    411021
   00860 Porphyrin and chlorophyll metabolism
    411021
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    411021
   00982 Drug metabolism - cytochrome P450
    411021
   00983 Drug metabolism - other enzymes
    411021
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     411021
Glycosyltransferases [BR:ame01003]
 Others
  Hydrophobic molecule
   411021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
Position
LG4
AA seq 519 aa AA seqDB search
MKFLLAIFITIVCAMYDDANGARILMMTPHQAKSHYIVYEALLKRLAERGHQVVSFNHFP
QKTVLPNFTDVDISSSMPYVVGTRSIELAYKRTMWQKLKSISHLSLPTCESVLEHPELKK
LLHSKEKFDMYIMEIFLSDCFIGIGHALKIPIVVGVSSTVSYPWTNDIFRNPDIPSYIPN
SVLSNFSDEMNFFERATNLMYLFISKLAYRYLADRPGYEIAKKHFGDDLPDLDTLRSKMS
LILTNGHRAVNTPRALAPEYKELGGMHIPASGPPPLPKDLKDFLDSSENGVIYFSLGSQI
NMSTLPNEVLMSFYEAFERVPQRILWKCIESNMPRLPKKVKCIEWAPQLSILCDPNVRLF
ISHGGMLGSQEAVYCGVPILGIPLYGDQHLNLAYFVKRGFALKLDYYQLSYVQEISNALN
ELLLNKSYRDMARKASFEFRDRLIPPLDEGVYWIEYLLRHGPDSLRTTAISLTWYQYLLL
DVILAIIISIVLTVFIVYKLFKLLVWKRRMSIDVNKKRS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctactcgcgatatttataacgattgtttgtgcgatgtacgacgatgccaat
ggcgccagaattttgatgatgactccgcaccaagcgaaaagtcactacatagtgtacgag
gcgttgctgaagaggcttgctgagaggggccaccaagtggtttcgttcaaccatttccca
cagaaaacagttttacctaatttcacggatgtcgatatatcttcgagcatgccgtacgtg
gtcggtacaaggtcgatcgagcttgcgtacaagcggaccatgtggcaaaaattgaaatcg
atatcccatttaagcttaccaacgtgtgaatctgtactcgagcatccggaattgaagaaa
cttctccattcgaaagagaagttcgatatgtacatcatggaaatcttcctctccgactgt
ttcatcggtatcggccacgctctcaaaataccaatcgtggttggagtaagtagcaccgtg
tcttatccatggacgaacgacatttttaggaatcctgacatccctagttacattcctaac
tcggttttaagcaatttttcggacgagatgaatttcttcgagagggccaccaatttgatg
taccttttcatcagcaagctcgcctataggtatctagcggacaggccaggttacgagatc
gcgaagaaacacttcggcgacgatcttccggacttggacacgttacgttcaaagatgtcg
ttgatactgacgaacgggcacagggctgtgaacacgccacgagccctcgctccagagtac
aaagaactgggcggtatgcacataccagcgtcgggccctccgccgttgcccaaagatctt
aaggattttctcgactcgagcgagaacggggtcatttacttcagcctgggatcgcagata
aacatgtccacactgcccaacgaggtgttaatgtctttctacgaggcattcgagcgggta
ccgcaacggatattgtggaagtgcatcgagagcaatatgcccaggctgcccaagaaagtt
aagtgcatcgaatgggcgccccagctctccatattgtgtgatccgaatgtgcggctattt
atctcgcacggtggaatgctgggatctcaagaggcggtttattgcggggtaccgattctc
ggcatacccctgtacggggatcaacacctgaacctggcctacttcgtgaaaagggggttc
gctctgaaactggattactatcaactttcatacgtgcaggagatatcaaacgctttgaac
gaactgctcctgaacaagagttacagggatatggcaaggaaagcctctttcgagttcagg
gatcgactgataccacccttggacgagggtgtttattggatagagtatttgcttcgccat
gggccagattcattgaggacaacggcaataagtttaacttggtaccaatatttattgctg
gacgttatactcgcgataataatttcaatcgtgttgacggtattcatcgtttacaagtta
tttaaattattagtttggaaaagaagaatgtcgatagatgttaataagaaacgatcgtga

DBGET integrated database retrieval system