KEGG   Apis mellifera (honey bee): 411106Help
Entry
411106            CDS       T01057                                 

Gene name
GB10409
Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    411106 (GB10409)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     411106 (GB10409)
Transfer RNA biogenesis [BR:ame03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    411106 (GB10409)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 313 aa AA seqDB search
MAQSACLLSRIMATSVSATVRAGKIIRDVMTHGSLNIVEKGKNDLQTEADRCAQRCIIAS
LSQQFPNITIIGEEEPSNCDIPYDWIVTDADQEMLQLKLPTHLEDIDPKDVCIWVDPLDV
KLMFLGTSEYAQGLVEHVTVLVGVAIGHRAIGGVIHQPYYKNNENEILGRTLWGINGVGF
GGFAPIAPPHGKIIVTTTSSHSNNNVQAAINALSPDEVLHVGGAGYKVILLMEGKAHAYV
FASNGCKRWDTCAPEAILHAIGGTLTDIYGEFYSYNAETTYSNERGVLATAPGQNHQWYL
NNIPYELKQKLEQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagtgcttgtttattatctcgaataatggccacttctgtatctgctactgta
agagcaggtaaaattataagagatgttatgactcatggaagtttaaatatagtagaaaaa
ggcaaaaatgatttacaaactgaagctgatcgttgtgctcaaaggtgtattattgcttca
ttaagccaacagtttccaaatattactattattggtgaagaggaaccatcaaactgtgat
ataccatatgattggattgtaactgatgcagatcaagaaatgttacaattaaaattacca
actcatttggaagatatagatcctaaggatgtgtgtatttgggtagatccattggatgtc
aagttaatgtttttaggaacatcagaatatgcacaaggccttgtagaacatgttacagta
ttagtaggagtggcaattggacatagagcaattggaggtgtaattcatcaaccatattac
aaaaataatgagaatgaaatattaggacgtactctttggggtattaatggtgtaggattt
ggtggatttgcaccaattgctccaccacatggaaaaataatagttacaaccacaagttca
cattcaaacaacaatgttcaagcagctataaatgctttatctcctgatgaagttttacat
gttggtggtgctggatataaagtaatacttttaatggaaggaaaagctcatgcttatgta
tttgctagtaatggttgtaaaagatgggatacttgtgcccctgaagctattcttcatgca
attggtggtacattaactgatatttatggagagttttattcttataatgcagaaacaaca
tattctaatgaaagaggtgtattagctactgcacctggtcaaaatcaccaatggtatttg
aataatataccatacgaactaaagcaaaaattagaacagtaa

DBGET integrated database retrieval system