KEGG   Apis mellifera (honey bee): 411132Help
Entry
411132            CDS       T01057                                 

Gene name
Tg, GB11241
Definition
transglutaminase
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     411132 (Tg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG5
AA seq 731 aa AA seqDB search
MFYRFYDRYRIFNDRRFRPFPFAFYWEDFTVPVLTILHVDPCIGENGAKHRTSRYEAMSR
NGDGSRLVVRRGQEFYLHLALSRDYDPDTDGISLVFTVDGAERPQYGHGTLVATPVLYPG
QRSEASWQAYIDSLHSNFLRLKIVPAPDAIIGKWRMDIDTKNKSTDGAVSFTMKHPFYLV
FNPWCKEDAVYMEGEDERQEYVMAEDGLIWRGSYNRPRRTVWKYSQFERDILDCALHLMI
EVGKVRVSARHDPVIISRVLSAAVNSPDDNGALMGNWSNDFGGGTPPTKWLGSQKILQQY
YKTRKPVKYGQCWVFSGVLATICRALGLPCRVVTNYSSAHDTQSSLTVDYFVDAEGKVMK
ELNRDSVWNFHVWNEVWMKRDDISAEYSGWQAIDATPQELSENAYRCGPASVIGVKRGDV
LRPYDNAFVFAEVNADIVFWRYNGPTQPLKLIQKDAYGIGQLISTKAVGKWTREDITHTY
KYPEKSEEERATMLKALRQSQSLFSRYYLNDEFNDVTFDFELRDDIVIGQPFSVVLSIKN
RSDRNEYEVSVILRVETVLYTGRVGDPVKRWSVNRVVMPRTVEEARMDVSWQEYGPRLLD
QCAFNVACLATVKDTNFEYFAQDDFRVRKPDIAIRLENEAVVGDELKATARFQNPLPIPL
NKGRFLIEGPGLDEQLKVKLPDPVRTGAYAECSFSMVPRYEGRATIAAKFYSNELEDVDG
FVNFMVKRNGD
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgttctatagattctacgatcgttaccggatcttcaacgatcgccgcttcagacccttc
cccttcgccttttattgggaggacttcacggtgccggtgctcacgattctgcacgtggac
ccgtgcatcggcgagaacggggctaagcacagaacgtcgaggtacgaggcgatgagccgg
aacggcgacgggtcgagactggtagtgagacgcggccaagagttctacctgcacctcgcc
ctgtccagggattacgacccggacacggacggcatatcgctggtgttcaccgtggacggg
gctgagaggccgcaatacggccacggcaccctggtcgcgacccccgtcctctaccccggc
cagcgatccgaggcttcttggcaggcttacatcgactcccttcactccaatttccttcga
ttgaagatcgtccccgcccccgacgcgataataggcaaatggaggatggacatcgacacg
aagaacaagagcacggacggggcggtgagtttcacgatgaagcaccccttctacctcgtg
ttcaacccttggtgcaaagaggacgcggtttacatggagggcgaggacgagaggcaggag
tacgtgatggcggaggacgggctgatatggcggggcagttacaatcgtcccaggcggacc
gtgtggaagtactcgcagttcgagcgcgacatattggactgcgctttgcacctgatgatc
gaggttggaaaagttcgagtctcggcgaggcacgatcccgtaattatatcgcgagtcttg
tccgcggcggtgaactcgccggacgacaacggggcgctgatgggtaattggtcgaacgat
ttcgggggtggcacgccgcccaccaagtggctcggctcgcagaagatactgcagcagtac
tacaagaccaggaaaccggtcaagtacggccagtgctgggtgttctcgggcgtgttggcc
accatttgccgtgccctcggactaccgtgccgcgttgtgaccaattactcgagcgcgcac
gacacccagagcagcctcaccgtcgactacttcgtggacgccgaggggaaagtgatgaag
gagttgaacagggactctgtctggaatttccacgtgtggaacgaggtgtggatgaaacgg
gacgacatatcggcggagtattccggttggcaggcgatcgacgcgaccccccaggagttg
agcgagaacgcttaccggtgcggccctgcctccgtgatcggcgtgaagaggggtgatgtg
cttcgcccgtacgacaacgctttcgtgttcgccgaggtgaacgcggacatagtgttctgg
cggtacaacgggcccacgcagccgttgaagctgatccagaaggacgcctacggaatcggg
caattgatcagcacgaaagcggtgggcaaatggacgagggaggacatcactcacacctac
aagtatccggagaaatcggaagaggagcgggccaccatgttgaaagcgttgcgccagagc
caatccctgttcagccgttattacctcaacgacgaatttaacgacgtcacgttcgacttc
gagcttcgggacgatatcgtgataggacaaccgttcagcgtggtgctgtcgatcaagaac
aggagcgatcgcaacgagtacgaggtgtcggtgattctgagggtggagacggtgctgtac
acggggagggtcggcgatccggtgaaaagatggagcgtgaaccgagtggtgatgccgagg
acggtcgaggaggcgcgcatggacgtgtcctggcaggagtacgggccccgattgttggat
caatgcgcgttcaacgttgcctgcctcgccaccgtcaaggacaccaatttcgaatacttc
gcgcaagacgattttcgcgtgaggaagccagacatcgcgatcaggttggagaacgaggcg
gtagttggggacgagttgaaggcgacggccaggttccagaatccgttaccgatcccgttg
aacaagggccgtttcctgatcgaggggccgggtttggacgagcagctgaaggtgaaattg
ccggatccggtgagaacgggggcgtacgccgagtgctcgttctccatggtgccgagatac
gagggacgcgccacgattgcggcgaaattttactccaacgagctcgaggacgtggacggt
ttcgtcaattttatggtgaaacggaacggcgattga

DBGET integrated database retrieval system