KEGG   Apis mellifera (honey bee): 411349Help
Entry
411349            CDS       T01057                                 

Gene name
GB17092
Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ame  Apis mellifera (honey bee)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    411349 (GB17092)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     411349 (GB17092)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG2
AA seq 525 aa AA seqDB search
MKNSDQRVMEDSGQIHSTLLEETFYVTSKKNTYYKVRLTEKGLSLEKDNNGTTKVETIVL
NDIIGCRCMRSKRKSAGSCVCGPGTSRSQFKLVESAEAYQCYDEFDTSAYLYIYAYTLKK
ARMKGVKRRERTTITLRFRSFDKYEDNLREASRWRLAIKCLIVGVPVPKSFMSPSHENLE
SLISACPGEQRKILVLLNPKSGPGRSRETFQKRIHPILSEAERPYEVHVTKCPNYAREFV
HTRDIYQWSGLVMVGGDGIVFDVVNGLFQRPDWEKALKELPLGVIPCGSGNGLAKSIAYA
KQEPYDYNPLLISALSVVKFKKAQMDLVRVETRNQILFSFLSVGWGLLADIDIESERLRA
IGGQRFTVWTIARLIGLRTYKGKVSYLPCDKVPSVESLGNGNAYNEYTKETQISHSRSCG
DDLDRYSKISESKSFHDTLDGDPAILDGSSDIYDDNEIISENITLETEIERRQRLDSFYS
ATSAKSTYFSTGSISSYHSVDEPDNENIGRRNKQIDPLFNYSKIC
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagtgatcagcgtgtcatggaggacagtggtcaaatacattctactcttctc
gaagaaaccttttacgttacatcaaaaaaaaacacttactacaaggtgagactaacagaa
aagggtcttagcctagagaaagacaataatggtacgacgaaggttgaaacgatcgttcta
aacgacataatagggtgtagatgtatgcgttcgaaacgtaaaagcgcgggaagctgtgtt
tgtgggccaggtacttcgagatctcaattcaagctagtcgagtctgcagaagcatatcaa
tgttatgatgagttcgatacctcggcctatctttatatctatgcttacacattgaaaaaa
gcacgcatgaaaggtgttaagagacgagaaaggacaacgatcacgctacggttccgcagt
tttgacaaatatgaagataatctacgagaagcaagcaggtggcgattagctataaaatgt
ctcattgttggtgtgcctgtgcctaaaagttttatgagtccgagccacgagaatcttgag
tcgttgattagtgcttgtccaggcgagcaacgaaagatactagtgttgctgaatccgaaa
tctggaccgggaagaagccgagaaacgttccagaaaagaattcatccgattctatcggaa
gcggagaggccttacgaggttcacgtcaccaagtgtcccaattacgcacgcgagttcgtg
catacgagggacatctatcaatggagcggactcgtgatggtcgggggcgacgggatagtg
ttcgacgtagtaaatggactttttcagaggcccgattgggagaaagctctgaaggaatta
ccccttggcgtgataccctgcggttccggtaatggcttggcgaaatccatcgcgtacgct
aaacaagaaccgtacgattacaatcctcttcttatcagtgcattatccgtggtaaaattc
aagaaagctcagatggatttggtgcgcgttgagactagaaatcagattctattttcattt
ttatcggttggatggggtttacttgctgacattgacattgagagcgaacgtctacgtgca
ataggcggtcagagattcactgtgtggactatcgcccgtttgattggcttgagaacgtac
aaaggaaaggtgtcttatttaccttgcgataaagtaccgtccgtggagagtttaggtaat
gggaatgcctacaatgaatacaccaaggaaacgcagatatcgcattcaaggagctgcggc
gacgatttagatcgatacagtaaaatcagtgaatcaaagagttttcacgatacgctcgat
ggagatcctgctattttggatggatcgtccgatatttacgatgataacgaaataataagc
gaaaatattaccctggaaacggaaattgagagaagacaaaggctagacagtttttattct
gcgacatctgcgaaatcgacttattttagtacaggttcaatttctagttaccatagtgtt
gacgaacccgataatgagaatattggaagaagaaataaacaaattgatccactttttaat
tattcaaaaatatgttaa

DBGET integrated database retrieval system