KEGG   Apis mellifera (honey bee): 411362Help
Entry
411362            CDS       T01057                                 

Gene name
GB15694
Definition
ubiquitin carboxyl-terminal hydrolase 8-like
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ame00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    411362 (GB15694)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     411362 (GB15694)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   411362 (GB15694)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 1001 aa AA seqDB search
MTEKTPLRYTSIKDLLQIARINYKGKRPSDIYKRLPDMFNLAENAKIRGDEENQYIMLRR
WLNCIDWLKTTQEYKDDKTFSLTNIHVNQINEVKKILGDLNRKLDARYKMQLKEKMLEKN
NIADKMDIDNESGIETYMTPIDGPIKLPETPTRDPLVSDNEEIINCDQLFQLMHKVDGRY
LIIDIRPKLQFETSRILSDKSVNIPNSKIKPGALTSHFEEYLHKDKKALDLFRHRGAQYV
DVIILIDWDTSSKTLTSENSLNVLRKILEDWDPGIKYKRIAILDGGYAEWITRYPAFTTN
PNIVEPTLDNVPDEILDNIEYPELIHFDEEENVIKSHENKSIKLKPISNNEITSKVSITN
DKMWYKHMETEISNNISTRSKNFIDSSIEIGKVPKDNTNLRQYDNSLKFQHKRNSLNIMK
KNVISTKPIVDRSNKPVSLDASTSESKSVLKLMKQLNELAKNKQELEQEILEQERTLYMQ
HGMKYKSSNEEEYIHSNVKSLCLKLEEKQKEYKKIEDELTKYYTKIESIKFNPAEENEKG
NLEFTLALLKRRMKDTSADRKKLREISMKNNYKELSIKENETNIHKEPLKSDNSSMGSNL
ERSYSSPNLLQLTDRKAPQIDRSSKPQVSSYNQNGTYGDNKVSHLSWANREERMTPVHGS
VHPGITGLKNLGNSCYMNSIIQCLSNTTHLAKYFMDNLYADDLNINNDNNTQGQVVEEVA
QVIKALWRGQYKSISPHDLKIAVGQYKLQFESYEQQDSHEFLTFLLDWMHNDLKKNCKVP
VEMTIAEKAWDKAMGSQRSIISDLFFGQLRSTITCSFCKQSSTTYETFNSLTMSLLHSNR
CTLNDCILKFVSGQKVIGWKCPKCQTAREATKKFDFVKLAPIIVIHLNRFAESGGWLEKR
NTAVDFPLTDFNLKPYLVTDNNSTTISNIRSYSYSYSLYAMSNHYGTMEGGHYTAFCKNA
AQNKWYKYDDQTVTEVSVNQVRSQNTSAYLLFYTSFSSNII
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaacacctttacgttataccagtataaaagatctattgcaaatagccaga
attaattacaaagggaaaagaccatctgatatttataaaaggcttcctgatatgtttaat
ctggctgaaaatgccaaaatacgaggagatgaggagaatcaatacatcatgttaaggaga
tggttgaactgtattgattggttgaaaaccacacaagaatataaagatgacaaaacattc
tccttaacaaatatacatgtgaatcagatcaatgaagtaaaaaaaatacttggagattta
aatcgaaagttagatgcacgttacaaaatgcaattaaaagaaaagatgttagaaaaaaat
aatattgcagataaaatggatatagataatgaaagtggaatagaaacttatatgactcct
attgatggtccaataaaattacctgaaacaccaaccagagatccattggtcagtgataat
gaagaaattataaactgtgatcagttatttcaattaatgcataaagtagatggtagatat
ttaattattgatataagacctaaattgcaatttgaaacttcaagaatattatctgacaaa
tctgttaacattcctaatagtaaaataaaacctggtgcattaacatcacattttgaagaa
tatcttcataaagataaaaaagcattagatttatttaggcatagaggagcacaatatgtc
gatgttataattctaattgattgggatacatcaagtaaaacattgacatccgaaaattcc
ttaaatgtattaaggaaaattttagaagattgggatcctggtataaaatataaaagaatt
gctattctagatggtggttatgcagaatggataactcgttatccagcatttacaacaaat
cctaatattgtagaacctactttagacaatgtcccagatgaaatattagataatatagag
taccctgaattgatacattttgatgaagaagaaaatgttattaagtcacatgaaaataaa
tcaattaaattaaaaccaataagtaataatgagattacatcaaaagttagcattacaaat
gataaaatgtggtacaaacatatggaaacggaaataagtaataatatttcaacgcgctct
aagaattttatcgatagctctattgaaataggaaaagttcctaaggacaatacaaattta
cgacagtacgataattcattgaaatttcaacacaaaagaaattcattgaatatcatgaaa
aaaaatgttatatctacaaaaccaatagtagatagaagtaataaaccagtttctttggac
gcgtctacatccgaatcgaaatcagttttaaaattaatgaaacaattaaatgaattagca
aagaataaacaagaattagaacaagaaattttagaacaagaacgtactttatatatgcaa
catggtatgaaatacaaaagttcaaatgaagaagaatacattcatagtaatgtaaaatct
ttgtgtttaaaattagaagaaaagcaaaaagaatataaaaaaattgaagatgaacttact
aaatattacacaaagatagaatcaattaaatttaatcctgcagaagaaaacgaaaaagga
aatctcgaatttactcttgctttactaaaacgtcgaatgaaagatacttctgcagatcga
aaaaaattacgagaaatatctatgaaaaataattacaaagaattgtcaataaaagaaaat
gaaactaacattcacaaggaacctctgaaatcagataattcttcaatgggaagcaattta
gagcgttcatattctagtccaaatttgttacagttgacagatcgtaaagcaccacaaata
gatagaagttcgaagccacaagtttcgtcgtacaatcaaaatggaacttatggtgataat
aaagtatcacatttaagttgggcaaatcgtgaagaaagaatgacacctgttcatggaagt
gtacatccaggtattacaggattgaaaaatttaggcaattcatgttatatgaatagtatt
atacagtgcttaagtaataccacgcatttagctaaatattttatggataatttatatgct
gatgacttaaatataaataatgataataatacgcaaggccaagttgtagaagaagtagct
caagtaattaaagcactttggagaggtcaatataagagtatatcaccacatgatcttaag
attgctgtgggacaatataaattacaatttgaaagttatgagcaacaggattctcatgaa
tttctcacttttcttctagattggatgcataatgatttaaaaaagaattgtaaagtgcct
gtggaaatgacaatagctgaaaaggcctgggataaggcaatgggatcacaaagatctata
atatctgatttatttttcgggcagttaagatccactattacgtgcagcttttgcaaacaa
agtagtacgacatatgagacttttaatagcttaacaatgtcattacttcattccaatcga
tgtacattaaatgattgcatcttaaaatttgtaagtggacaaaaggtgataggatggaaa
tgtccaaaatgtcaaacagctcgagaagctacaaaaaaattcgactttgtgaaattagcg
cctattatagttatacatttaaaccgttttgctgaaagtggtggatggctcgagaaacga
aatactgctgttgattttcctctaacggatttcaatttaaaaccatatttagtgacagat
aataatagtactacaatttcaaatattcgcagttatagttatagttatagtttatatgca
atgtctaatcattatggaactatggaaggtggtcattacacggccttctgtaaaaacgct
gctcagaataaatggtataaatatgatgatcaaacagttacagaagtttcggtaaatcaa
gtaaggtctcaaaataccagtgcctatctattattttatacatctttttcaagcaatatt
atttag

DBGET integrated database retrieval system