KEGG   Apis mellifera (honey bee): 411490Help
Entry
411490            CDS       T01057                                 

Gene name
FDL
Definition
(RefSeq) probable beta-hexosaminidase fdl
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    411490 (FDL)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     411490 (FDL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
Position
LG9
AA seq 750 aa AA seqDB search
MRARRSTLQRLQCATDCVHIEGYSLNTELRSIKRGTGTWKFPRRENNADTTTGEAILQSK
ATGNTVSRIDYTMVRPSRKRGFFLETFARMVGNMSSGWMRKILLFLVLITGILLIAMYAH
APPLASLQPFSSRRLKELQRGLVTFLVGNESTKRPGERLYEYLEEPRTFQSPWSWVCVAG
RCERRAVRSSRTSLASCIALCGGNTRLLWPRPTGNVLLAEESVIVHLQQIEFVTVNTSDQ
ETRNLLEHAKDVFIGNIRSLIKTPSAKSRPGVDAFVIYLSAGSGAATGPSLDVDESYTVD
LAAKGRVLEARVVGRSYFGARHGLETLGQMIWWDETSGREGGLRVLSRASVEDKPTFPYR
GLLIDTGRQFFPVERLKRVIDGMAASKLNTFHWHISDSQSFPFDSAQFPEMARWGAYSGD
QIYTPDDVKDLADYARIRGVRVLVEIDSPAHAGAGWQWGTEYGYGELALCVDQQPWSSYC
GEPNCGQLNPINEHTYRILEGLYKELLELTGIRDVVHLGGDEVNLDCWAQYGNITAAMQA
QNMTDHHAMWAEFETKMLHRLVKANRDETPKAVILWSSPLTKRPYITTYFDPKIHVIQSW
GGSNWPETPDLLEDGFRVILSHVDTWYLDCGFGRWRETGEAACGEYRTWQTVYNHRPWRD
YPQQHWGLVLGGEAAIWSEQTGDASLGPRLWPRASALAERLWSDTPTNGYSTDENVYTRL
AAHMELLTSRGLKTEAMWPQWCSQNPGKCL
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgaggcgaagtacacttcagcggcttcagtgtgccactgattgtgtacacatc
gaagggtattccctaaacactgaactgagatcgatcaagaggggaaccggtacatggaag
tttcctcgtagggagaacaacgcggatacaacaaccggagaagcgatcctgcagagcaag
gcgacaggaaacactgtctcccgaatcgattacacgatggtacgtccgtcgagaaagcga
ggattcttcctggaaacattcgcaaggatggtgggcaacatgtcgagcggatggatgagg
aagatcctccttttccttgttctgataaccgggatcctgctgatcgcgatgtacgctcac
gccccgccactcgcctcccttcagccgttctcgtcgcgacgactgaaggagttgcaacga
ggcttggttacattcctggtcggtaatgaaagcacgaagagacccggagaacggctctac
gagtatctggaagagcctaggacgtttcagagcccgtggtcttgggtgtgcgtggccggg
agatgcgagaggagggcggtgagatcgtcgaggacctcgctggcaagttgcatcgcgctc
tgcggcggaaacacgaggcttctgtggccgaggccgaccggaaacgtgctgctcgccgag
gagagcgtgatcgtacacctgcagcaaatcgaattcgtcacggtgaacaccagcgatcaa
gagacgaggaatctgttggagcacgccaaggacgtcttcatcggcaacatcaggagcttg
ataaagacgccgagcgcgaagagcaggccaggggtggacgcgttcgtgatatacttgtcc
gcggggagcggggcagcgacagggccgagcctggacgtggacgagtcgtacaccgtcgac
ctggcggcgaaggggagggtgttggaggcccgggtggtcgggaggagctacttcggggcc
aggcacgggttggagacgcttggccagatgatctggtgggacgagacgagcggcagggag
ggcgggttgcgggtgctgtcccgcgcctcggtcgaggacaagcccacgttcccctacagg
ggactgctgatcgacacggggaggcagttcttccccgtcgagcgtttgaaacgcgtgatc
gacgggatggcggcgtccaagttgaacaccttccactggcacatatccgattcccagagc
ttccccttcgactcggcccaattcccggagatggccaggtggggggcgtacagcggggac
cagatctacacgcccgacgacgtcaaggatctggccgactacgcgaggatacgcggcgtc
cgagtcctcgtcgagatcgactcgccggcgcacgctggcgccggctggcaatgggggacg
gagtacggttacggggagctggcactgtgcgttgatcagcagccatggtcgtcgtattgc
ggcgagccgaattgcggccagttgaatcccatcaacgagcacacgtaccgaatactcgag
ggcctgtacaaggagctgctcgagctgaccgggatccgggacgtggtccatctcggcggg
gacgaggtgaacctcgactgttgggcccagtacgggaacatcacggccgcgatgcaggcc
cagaacatgaccgaccaccacgcaatgtgggccgagttcgagaccaagatgctgcacaga
ttggtcaaagcgaatcgagacgaaacgcccaaggccgtgatcctgtggagctcccccctc
acgaagaggccgtacatcaccacctacttcgaccccaagattcacgtgatccagtcgtgg
gggggcagcaattggcccgagacccccgacctcctcgaggacgggttcagggtgatcctc
tcgcacgtggacacctggtacctggactgcgggttcggcaggtggagggagacgggggag
gcggcctgcggcgagtaccgcacctggcagaccgtctacaaccacaggccgtggcgggac
tacccccagcagcactggggcctcgtcctgggcggggaggcggcgatatggagcgagcag
acgggcgacgcgtcgttgggcccccgactgtggcccagggcgtccgccctagccgagaga
ctctggagcgacacgccgaccaacggttattccacggacgagaacgtgtacacgaggctg
gccgcgcacatggagcttctgacgagccggggattgaagacggaggcgatgtggccgcaa
tggtgctcccagaacccgggcaaatgtctctga

DBGET integrated database retrieval system