KEGG   Apis mellifera (honey bee): 411503Help
Entry
411503            CDS       T01057                                 

Gene name
HDAC1, GB14706, Rpd3
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ame  Apis mellifera (honey bee)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    411503 (HDAC1)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     411503 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 492 aa AA seqDB search
MSALPHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
ADEMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDESYESI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGG
GGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLE
KIKTRLFENLRMLPHAPGVQVQSIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENE
YSDSEEEGEGGRRDNRSFKGSRKRPRLEKGQEGIESDLKKEEDIKSEPKENEKDEKTNIT
NEETKKDGGANP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttacctcacagtaagaagcgtgtctgctactattatgatagtgatattgga
aattattattatggacaaggacatcctatgaagccacatcgtataaggatgacacataat
ttattgttaaattatgggctttataggaaaatggaaatatatcgtccacataaagctact
gctgatgaaatgacaaaatttcatagcgatgattatattagatttttgagatccataaga
cctgataatatgtctgagtataacaaacaaatgcaacgatttaatgtaggagaagattgt
cctgtttttgatggtttgtatgaattctgtcaactatcagctggaggttctgtagctgct
gcggtgaaacttaacaaacaagcttcagagatttgcataaattggggtggtggtttacat
catgccaaaaaaagtgaagcatctggcttttgttatgtaaatgacattgtattaggaata
ttagaattactcaaatatcatcaaagagttctttatattgacattgatgttcatcacggg
gatggtgtagaagaagctttttatactactgatagagtgatgacagtttcttttcataaa
tatggtgaatattttcctggcactggtgacctccgtgatattggtgcgggaaaggggaaa
tattatgcagttaatataccactaagagatggtatggatgatgaaagttatgagtcaata
tttgtacctatcatttcaaaagtaatggaaacttttcagccctctgctgtagtcctacaa
tgtggtgctgattctctgacaggggatcggttaggttgcttcaatttaacagtaagaggt
catggaaaatgcgttgaatttgtaaaaaaatataatttaccttttttaatggttggtggc
ggtggatatacaattaggaatgtatccagatgttggacatatgaaacttcggttgctctt
ggttcagaaattgcaaatgaattaccttataatgattattttgaatattttggacctgat
tttaaattgcatattagcccttcaaatatggcaaatcaaaatactcctgaatatcttgaa
aaaattaaaaccagattatttgaaaatctaagaatgttgcctcatgcaccaggagtgcaa
gttcaatcaattccagaagatggtgcagtcattgaagattcagaagccgaagaaaaagtg
aatccagatgaaagattacctcaacgagatttagataaaaggatacaacacgaaaatgaa
tacagtgatagtgaagaagagggagaaggaggacgaagagataacagatcatttaaaggc
tctagaaaaagacctcgtttagaaaaaggacaagaaggtattgaaagtgatttaaaaaaa
gaagaagatataaaatccgaaccaaaagagaatgaaaaagatgaaaaaacaaatattaca
aatgaagagacaaaaaaagatggtggagcgaatccctga

DBGET integrated database retrieval system