KEGG   Apis mellifera (honey bee): 411525Help
Entry
411525            CDS       T01057                                 

Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00564  Glycerophospholipid metabolism
ame01100  Metabolic pathways
Module
ame_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
ame_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    411525
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     411525
    2.7.1.82  ethanolamine kinase
     411525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 411525
NCBI-ProteinID: XP_006557352
BEEBASE: GB40312
Position
LG16
AA seq 395 aa AA seqDB search
MQDSILQISRITKESKMGLGNKMSEENPEMREMAARICRDYLHGVWKHVTAENIILKRIS
GGLSNWLYNVQLPDETVPIRGEPRQVLLRLYGQIHGERALEGLITESVIFTLLSERRLGP
KLHGIFPGGRIEEYIPARPLLTKELADPTLSCMIAEKMAQIHCMQVPISKEPTWLWDTMA
KWLDTTRDILENIEDIDVRHLKNVNMIRIIDLDHEIKWFRSLATRHKYPVVFCHNDMQEG
NILLRQNTRKPELVLIDFEYCSYNYRAFDIANHFVEWQYDYTAAEYPFFHERTGSGPTKE
QKLNFVRSYLKTIGKEGPTEEERIMMEIKIFFLASHLFWGLWSIVNAKLSEIPFGYWDYA
VSRLKNYQYLKEKITVCGSPTIDNIDIAKKETVVD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattcaatactacaaatttctcgaataacaaaagagtctaagatgggtttggga
aacaagatgtctgaggagaatccggagatgcgggaaatggcagcgcgtatttgtcgcgat
tatcttcatggagtttggaaacacgttaccgcggaaaacataatattgaaacgtattagt
ggtggattaagcaattggttatacaatgtccaattaccagatgaaactgtcccgattcga
ggtgagcctcggcaagttttgttacgattgtatggtcaaatacatggagaaagagctttg
gaaggattgatcaccgaatcggtgatcttcacattattgtcggaaaggcgacttggaccc
aaattacacggtatatttcctggcggtcgaatagaagaatatataccggcaagaccgtta
cttaccaaagaattggcggatccgactttgagctgtatgatcgctgaaaaaatggcgcag
attcattgcatgcaagttcccataagcaaagagccaacttggctttgggatactatggct
aaatggttagatacgactagagatattttagagaacatcgaagatatagatgtccggcac
ttgaagaatgtgaacatgatacgaataattgatttagatcacgagattaaatggttcaga
tcgcttgcaacccgacataaatatccagttgtattttgtcataatgatatgcaagagggt
aatatattgctgcgacaaaatacacggaaaccagaacttgttcttatcgactttgaatat
tgttcttataattatcgggcatttgacatagcaaatcactttgtggaatggcaatatgat
tatacggcagcggaatatcctttctttcacgaacgcacaggatctggtcctacaaaagag
caaaagctcaactttgtaagaagttacttgaaaacaatcggcaaagaaggtccgacggaa
gaggaaagaatcatgatggaaatcaagatattctttttggctagtcacttgttctggggc
ctttggagtattgtaaatgcgaaattatccgaaattccattcggatattgggattatgca
gtttcgagattaaaaaattatcagtatttgaaagaaaaaattacagtttgtggatcacca
acgatcgataatattgatattgctaaaaaagaaactgtagtggattga

DBGET integrated database retrieval system