KEGG   Apis mellifera (honey bee): 411812Help
Entry
411812            CDS       T01057                                 

Gene name
GB19218
Definition
uncharacterized LOC411812
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG12
AA seq 730 aa AA seqDB search
MFIFAPRDNMSTSRQDSAGRRNRYARSSTTTSVTQLLSDSCSSLLQRLTTRVRGTSTVND
NMVNKPTIITRHSPIVNQLNSARARIEDKYCTILDKYSRKKHADRPSVDYGPRTRERDTY
FRREDSPFVRDEKTLEPSMTRTVIKSPTSVVLSEKAYPYVKSSNVKEFKREKTPGYHRTD
KHSLLNSDTYKRYGRHKSGHAETRTRKVRPYRNGKSEQLESSSTALRLARPMKLESLTPK
EKNEEDPDKTPTSSVAKETVTNDNVAVATVEVEESDPAISERAAKRKEIQSLILKYAAME
ETYSQLAAGGQVKMRPSTTDKIASKYKKSTRQSERKDASKSAMAASVVDNHVDAIQHAIS
PRPPSVEDDEDGHLVYQSGDILANRYKVLATLGEGTFGKVVKVKDLQMDHVMALKIIKNV
EKYREAAKLEINALEKIATKDPEGQHLCVKMLDWFNYHGHMCIAFEMLGLSVFDFLRDNS
YQPYPLEHVRHIGYQLCYAVKFLHDNKLTHTDLKPENILFVDSDYDSIYSSKKRRDIRRV
KRTDIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGI
TLFQTHDNREHLAMMERILGTIPHRMARKTKTKYFYHGKLDWDDKSSAGRYVRDNCKPLH
RCMLSDDEEHRQLFDLIQKMLEYEPSQRITLKDSLAHPFFDALPAHQRLPDLRAAGDSQQ
SHERSHSLSR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcttcgcgccacgcgacaatatgtcgacgtctcgtcaggattcggcgggccgg
cgaaatcggtacgcgcgttcctcgacaaccacgagcgtcactcaactactcagcgactcg
tgctcgagtctgttgcaaaggctgaccaccagagttcgcgggacgtcgaccgtgaacgac
aacatggtgaacaaacctacaattattaccaggcattctcctatagtcaaccaattgaac
agcgccagggctcgcatagaggacaagtattgcaccattttggacaaatattccaggaag
aagcatgcagatcgtccctcggtcgattacgggccacgtacccgcgagagagacacgtat
tttcgccgcgaagacagtccgttcgttcgagatgagaaaactttggaaccttcgatgacc
cgcaccgtgatcaagagtcctaccagcgtggtcctttccgagaaagcgtatccttacgta
aaatcctccaatgtgaaagagttcaaacgcgagaagacgcccggatatcatcgtacggac
aaacactctttgttgaactcggatacctacaaaaggtatggaagacacaagtctggccac
gcagagacacgtaccagaaaagtgagaccctatcgaaatggaaagagcgagcaattggaa
tcctcgtcgactgctcttcgactagccagacctatgaaactggaatcattgacaccgaaa
gagaagaacgaggaagatcctgacaagacaccgactagcagcgtggctaaagaaactgtg
acgaacgataacgttgctgtcgcaacagtcgaggttgaagaaagcgatccagcgatttct
gagagagcagcgaaacgaaaggagatacaaagtttgattttaaaatatgccgctatggaa
gagacgtacagccagttggcggcgggtggccaggtgaagatgaggccgagtaccacggac
aaaatcgccagcaaatataagaaaagcacgcgccaaagcgaacgaaaagacgcgtcgaag
agcgcgatggccgcgagtgttgttgacaaccacgtggacgcgattcaacacgcgattagc
ccacgaccgccctccgtcgaggacgacgaagacggccaccttgtttaccaatccggcgac
atcctggcaaatagatataaagtactggccaccctaggagagggtacttttggaaaagtt
gtcaaggttaaggacttgcaaatggatcacgtgatggcgctgaaaatcatcaagaacgta
gagaagtatagggaagccgcgaagctcgaaataaacgccttagagaaaattgcgaccaag
gatccggaaggccaacacttgtgcgtgaaaatgctcgattggtttaattatcacggacat
atgtgtatcgccttcgaaatgcttggacttagcgtatttgatttcttgagagataacagt
tatcagccttatccattggaacatgtcaggcacattggatatcaattatgttatgccgtc
aaattcctacatgataataaactcacgcacactgatttgaaaccagaaaatatattattc
gtagattccgattatgatagtatatatagtagcaaaaagcgaagagatattagacgtgta
aaacggacagatattagactcattgattttggtagtgccacatttgatcatgaacatcac
agcacgattgttagcacaagacattacagagcgcctgaagtaattttagaattaggatgg
tctcagccttgtgacgtatggtcgattggctgcattctcttcgaactgtacctgggtatt
actttattccaaacacacgacaaccgtgaacatttagcaatgatggaacgtatacttggt
acaattccacaccgtatggcccgtaaaactaaaactaaatacttctatcatggcaaatta
gattgggacgataaaagctcagcaggcagatatgttcgagataattgcaaacctttacat
cgttgtatgctttctgatgacgaagaacatcgacaattgttcgatctcattcaaaaaatg
ttagaatatgaaccatcacagaggataacattgaaggattcattggcacatccctttttt
gatgcgttacctgcacatcaaagattaccagatcttcgagcagctggtgattcccaacaa
agtcacgaacgatcacattctctctcacgatga

DBGET integrated database retrieval system