KEGG   Apis mellifera (honey bee): 411905Help
Entry
411905            CDS       T01057                                 

Gene name
GB19614
Definition
bifunctional protein NCOAT-like
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     411905 (GB19614)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     411905 (GB19614)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 923 aa AA seqDB search
MAETNGAANINTKNDNFICGVVEGFYGRPWTTEQRKDLFQKLKKWGMDSYLYAPKDDYKH
RAYWRDLYTVEEAEHLTGLITAARECGITFYYALSPGLDITYSSVKEVTVLKRKLEQVSQ
FGCTAFALLFDDIEPEMSEADKEVFQSFAHAQVSVTNDIFHHLGQPRFLLCPTQYCATRA
MPNVASSEYLNTLGSKLAQEIDIMWTGPKVISRLLTVESIEEITEVLRRPPVIWDNLHAN
DYDQKRVFLGPYSGRSPDLIPKLRGVLTNPNCEYGANFIAIHTLAQWSRCNVDGKRDLSL
NDTVSADIKLETETEDGMLGEDVPSTMSPNIYHPRHALKNAINDWLVEFNKKRNAWGVIA
KPQPCVAPTIPIPIIPSVNTCMSLTSTTTTTTVPATPTPVNNSNHLQALAEVCSNVTTTD
NYVPPPTGPVMNSLVSETTVVSEPIIPSISTIVENVPNSNTLSSMEPMDCNTTPNNSPAH
AVKIQTEDDVMTCSEASGSMQVEVDSTSPVVNGTQMIVENDNENHDNGDNIDQESQDLID
VDKRLTQEDLSLLCDLFYLPFEHGGQGIQLLQEFNWLKSNAHVVMRKSKEDQTASESDIE
EWHTRAAKLNDMCNAVNRLFQRLTHCNNRELLYDLYSYVWDMRGVVSLLNSYVKWLAFGR
FPSTMTTFTQGSYTWFSNGWKETFMSGDQEPWVFRGGLTADLQRLIPVDSGNDLFVYKAP
EVPSSKIYTIRPYLASDEDAVYAVCNKICNCVTSSAIADRLVGGFLTLSPELCMVVEDES
GIVGYALAALNVKSYYQKLAVSWIPELRMKYPLDDNINDLSQNVQDAIRYFHSFVPDVSD
QLCRQHPSKLLCAVLPSVTDQSVPKRLITCILAALRANGSFGVHTTMSCTDKESHEFYSK
LGFVDLNPAHEEHPGIKTMCRSF
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcggagacaaatggggccgcaaatataaatacgaaaaacgacaattttatttgcggt
gttgtcgaaggattttatgggcgaccttggactacagaacaaagaaaggatttatttcaa
aaattaaaaaaatggggaatggattcgtatttatatgctccaaaagatgattataagcat
cgtgcatattggagagatttatatacagtagaagaagctgaacatttaacaggattaata
acagctgcaagagaatgcggcattacattttattatgcattatcaccaggcttggatatc
acatattcaagtgtaaaagaagttactgtattaaaaaggaaattagaacaagttagccaa
tttggatgtactgcatttgcattattatttgacgatatagaaccagaaatgagtgaagca
gataaggaagtatttcaatcttttgctcatgcacaagtttctgttacaaatgatattttc
catcatcttggtcaacccagatttctattatgtccaacacaatattgtgcaactagagca
atgccaaatgtagcatcatcagaatatttaaatacacttggtagtaaattggcccaagaa
attgatataatgtggactggtcctaaagtaatatctagacttctaactgttgagtctatt
gaagaaattacagaagttttgagaaggccaccagtaatatgggataatttacatgctaat
gattatgatcaaaaacgtgtattcttaggaccatattctggtagatctcctgatttaata
cctaaactgagaggtgttttaactaatcctaattgtgaatatggagcaaattttatagca
attcacacattagctcaatggagtagatgtaatgttgatggcaaaagagatttaagctta
aatgatactgtatcagctgatataaaattagagactgaaacggaagatggaatgcttggt
gaagatgttccttcaacaatgtctccgaatatatatcatcctcgacatgctttgaaaaat
gccattaacgattggttagtggaatttaacaaaaaacgaaacgcatggggtgttatagca
aaaccacaaccatgcgttgctccaacaataccaatcccaataattccctctgtgaataca
tgtatgagtctcacatcaacgacgactactactaccgtccccgcaacgcctactccagta
aataattcaaatcatcttcaagcattggctgaagtttgctcaaatgtaacaaccactgat
aattatgtgccacctcccactggtcctgttatgaattctttagtatctgaaacaactgtt
gttagtgaacccattattccatcaatttctactattgtggaaaatgtaccaaattcaaat
actttatcatccatggaaccaatggattgtaacacaacacctaataattccccagcacat
gcagttaaaattcaaacagaggatgatgttatgacgtgtagtgaagcatctggtagtatg
caagtagaagtagatagcacctctcctgttgtaaatggtactcaaatgattgttgaaaat
gataacgaaaatcatgacaacggcgataatatagatcaagaatcacaggatttgattgat
gtcgataagcgattgacgcaagaagatctatcacttttatgtgatcttttttatttgcca
tttgaacatggtggtcaaggtattcaattattgcaagagtttaattggttaaaaagtaat
gctcacgtcgtcatgagaaaatcaaaagaggatcaaactgcatctgaatctgatatcgaa
gaatggcatacacgggcagctaagttaaatgatatgtgcaatgctgtaaatagattattt
cagagacttacgcactgtaataatcgtgagttgttatatgatctatattcgtatgtgtgg
gacatgcgaggagtcgtgtctctcttaaacagttatgtgaaatggttggcgtttggcaga
ttcccgtcgacgatgacaacgtttacccagggaagctacacatggttctcgaatggctgg
aaagaaacttttatgagtggagatcaagaaccatgggtattccgtggtggacttacggct
gatctacagagattaattccagtagacagtggaaatgacttatttgtttataaagcacca
gaagtgcccagtagtaaaatctatacaattaggccttatttagcaagtgacgaagatgca
gtttatgctgtgtgcaataaaatttgcaattgtgtaacgtcttctgccattgcagatcga
ttagttggaggtttcctaactttaagtccagagctgtgtatggtagttgaagatgagagt
ggaatagtaggttatgcattggctgccttaaatgtaaagtcctattatcaaaaattagca
gtttcttggattcctgagttgcgaatgaaatatcctttagatgacaatatcaatgacttg
tcacaaaatgttcaggatgccatacgttattttcattcatttgttccggatgtgtctgat
caattatgtagacaacatccatcgaaattattatgcgctgtattaccaagtgtaacagac
caatctgtccctaaaagattaattacttgtattcttgcagctctaagagcaaatggttcg
tttggtgtgcatacaacaatgtcatgcactgacaaagaatctcatgaattttatagtaaa
ctcggcttcgttgatttaaatccagcacacgaagaacatcccggaattaaaactatgtgt
agaagtttctaa

DBGET integrated database retrieval system