KEGG   Apis mellifera (honey bee): 411915Help
Entry
411915            CDS       T01057                                 

Gene name
p38b
Definition
(RefSeq) mitogen-activated protein kinase 14B
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    411915 (p38b)
   04068 FoxO signaling pathway
    411915 (p38b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    411915 (p38b)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     411915 (p38b)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   411915 (p38b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 360 aa AA seqDB search
MPQFHKVEINRTEWEVPERYQMLTPVGSGAYGQVCSALDTKTGQKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENIIGLLDVFHPSSSLEDFQQVYLVTHLMGADLNNIVRTQKLSD
DHVQFLVYQIFRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDHLTRVLVLCGTPTE
ETLNKITSQEARNYIQSLPPLKKKNFKDVFRGANPLAIDLLELMLELDAEKRITAEQALA
HPYLAQYADPTDEPVSLPYDQSFEDMDLPVEKWKELVYHEVINFVPQQLPTIASGIESTS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtttcataaagtcgaaataaataggaccgaatgggaggttccggaacgatat
caaatgttaacaccagtaggatcgggagcttatggacaagtgtgttcagcacttgataca
aaaactggtcagaaagtagcaataaaaaaattagctaggccattccaatcagctgtacat
gcaaaacgcacctatagagaacttcgtatgttgaaacacatgaatcatgaaaatataatt
ggtttattagatgtttttcatccatcttcttctttagaagattttcaacaagtatattta
gtgacgcatctgatgggtgcagatctcaataatattgtaagaactcaaaagctttctgat
gatcatgtacaatttcttgtttatcaaatttttcgtggtctcaaatatattcattccgcg
ggtataatacatagggatttgaagccttctaacatagctgtaaatgaggattgtgagctg
aaaattttagattttggattggctaggcctacagaaaatgaaatgactggttatgttgct
acaagatggtatagagctccagaaattatgctcaattggatgcattacaatcaaacagtt
gatatttggtctgttggatgtataatggctgaactattaacagggcgaacattatttccg
ggaacagatcacattgatcatctaacacgagtcttagtactctgtggaacacccacagag
gaaactttaaacaaaattaccagccaagaggcaagaaactatatacaaagtttacctccg
cttaaaaaaaagaatttcaaagatgttttccgcggagccaatcctttagctatagattta
cttgaattaatgttagaattagatgctgagaaacgcattacagcagaacaagctttagct
catccatatcttgcacaatatgctgatccaactgatgaaccagtatctttaccttatgat
caaagttttgaagatatggatttacctgttgaaaaatggaaagaacttgtttatcatgaa
gttataaattttgtacctcaacaattacctacaatagcttcgggtattgagtctacttcg
taa

DBGET integrated database retrieval system