KEGG   Apis mellifera (honey bee): 411915Help
Entry
411915            CDS       T01057                                 

Gene name
p38b, GB15606
Definition
p38 map kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ame04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 360 aa AA seqDB search
MPQFHKVEINRTEWEVPERYQMLTPVGSGAYGQVCSALDTKTGQKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENIIGLLDVFHPSSSLEDFQQVYLVTHLMGADLNNIVRTQKLSD
DHVQFLVYQIFRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDHLTRVLVLCGTPTE
ETLNKITSQEARNYIQSLPPLKKKNFKDVFRGANPLAIDLLELMLELDAEKRITAEQALA
HPYLAQYADPTDEPVSLPYDQSFEDMDLPVEKWKELVYHEVINFVPQQLPTIASGIESTS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtttcataaagtcgaaataaataggaccgaatgggaggttccggaacgatat
caaatgttaacaccagtaggatcgggagcttatggacaagtgtgttcagcacttgataca
aaaactggtcagaaagtagcaataaaaaaattagctaggccattccaatcagctgtacat
gcaaaacgcacctatagagaacttcgtatgttgaaacacatgaatcatgaaaatataatt
ggtttattagatgtttttcatccatcttcttctttagaagattttcaacaagtatattta
gtgacgcatctgatgggtgcagatctcaataatattgtaagaactcaaaagctttctgat
gatcatgtacaatttcttgtttatcaaatttttcgtggtctcaaatatattcattccgcg
ggtataatacatagggatttgaagccttctaacatagctgtaaatgaggattgtgagctg
aaaattttagattttggattggctaggcctacagaaaatgaaatgactggttatgttgct
acaagatggtatagagctccagaaattatgctcaattggatgcattacaatcaaacagtt
gatatttggtctgttggatgtataatggctgaactattaacagggcgaacattatttccg
ggaacagatcacattgatcatctaacacgagtcttagtactctgtggaacacccacagag
gaaactttaaacaaaattaccagccaagaggcaagaaactatatacaaagtttacctccg
cttaaaaaaaagaatttcaaagatgttttccgcggagccaatcctttagctatagattta
cttgaattaatgttagaattagatgctgagaaacgcattacagcagaacaagctttagct
catccatatcttgcacaatatgctgatccaactgatgaaccagtatctttaccttatgat
caaagttttgaagatatggatttacctgttgaaaaatggaaagaacttgtttatcatgaa
gttataaattttgtacctcaacaattacctacaatagcttcgggtattgagtctacttcg
taa

DBGET integrated database retrieval system