KEGG   Apis mellifera (honey bee): 411918Help
Entry
411918            CDS       T01057                                 

Gene name
NUP205, GB18099
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    411918 (NUP205)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     411918 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 1918 aa AA seqDB search
MSEEKGTTQDMWTSYKELQNLVERYITSSSTTHDLHEFTETLRNHRQNFLTLLENPPPNK
NSREEIIKGATDGITLPDLGHQLLSKELVDETLIISDMYKLNEFMALDLLCTAQLQMPYH
PSLPRGLTAILLYYDGKKALTSTLRMLVQARMGHSWKIDASLALLRHITEYMNKLQDDLL
DRILSLLEKMDPIKEQELLEKNRALGGPKHRYMVMKLYNDSRQDLADILYLWSAQSSLPN
SILFRLLSLLQTKQIGPEAYEEGPDKVTLAIIMSVLNAINFSSFSTRENGEELINSMPLI
LERGAHEELYQKLITPNINWECAGLRGIIQFAFAVALTTIKTAANIQILNITTEDERLLE
AALTNKCFHFMAEILFKNKSIYYEEFYLRYFHSLISDFILLMPLKVKDLRSRADESMRLI
QAYQQEGIEPPLNLDNHFEYLMLTIAELYKEDPLKLKLVNDYWCYTDSTHTSDSAHIKRS
LSREVALFKFVRLAGEILPAGLFVPYLKMIASLACSPEAAKQAFSFLKPNGSSGSTTISW
DHFFKSLSLYYDNLRTELPPSQDTVYRQRSHPKGITPEEVKGLEAVLLVVRVIAKNDIED
RLRRDIYYHPGWKVIPSLIGLVSCGISIPLKSVLIRTLAALVMSSETSFTVWQSLEAAQI
VPNIPTISSYQPRGVQTELEEIESKKDEYPLTRAMLELLDVLTNFPILRLSGMGQRNPGF
DQYLRFIINTVFLKFHTRSYKNPGEKWEVSEACLKIFLKLIKQYEPAVEDFTGCKVELQS
GEVTMVNSGYYIMTQLHSKSELLHVILYILDKGCTNFDTYELFPGKKNLENSTLYCLEIL
ERGLNTQHNYMAQSAAAKSIHTILTGLSRLLLEVDPQSKRPDYMINIAKYVSYSSWLPQH
AFHAVGIIYEVTNEPGADSELLSMFTATPALTTNIRHGFVECLDADEDTENEKQYTGSCK
NRILLLMMQSLRRPTPNLSHYLLGFEITKDIKKTVLQQPGILGFPRTCLHSILGILEQSL
ERGRDKITEACYCLLYMLAENSKTFVSVLRFLRTSANQDFIQRHLSKLPFEGWNTIIELG
CMSWLLKIAAIELRVAGGSSQNSLIQRLVGNFGQEKGQIVPSQKLLMDLLHYIEFQFQLE
SSLCLDFFDPSQVEMVFARCSVPVTLVGGPRLIEIKKLYSIITEELAVTQSSAIATQRNP
MQDEVQKILKYALERNQTKLLSYATVKFLEGWCQTTEILFCVATNQQLPTPQKQNLLLNL
SHDLLQKMTSCEALSEIKTLVSGTVLMLLVHLRNSFITQTDSESFPSSPSNATMMKIILS
HILQWIINAGASSQKVITHLYAVLLNFLCVVGLEKSENTNIIDLMYVNQLDSSMNRVMPI
QERSHRYATIQVINSFGNKLMDILCHNCSGGHDVSKMLALSCLDKILELDYDNAWIMYLT
SRGYLKHMIESLLESDKMLQNMLHPEPQTLRPLYLYEAKMATFCRMASTRLGAESLLENK
ILSCMSSMTAFNYHPDVPLGFSVRNPHSFTPSPGQRYQQILLPALYLCDALLTTLGTENQ
SCAIQVCGFLQSHRGIIEMVLRDAYQEPNALILKEMACLTGVISRSANIDMYKLVDEELD
KADFELEDVSGIRELRAHLYRLQRLMLALLYKFQLQPAPSCLNHKNVEENEKHISRVQIV
ANIMLYTRNQMQHNRMDQKIRNVLFEPHLTLKPRGREDRIKDTSGGVHLGTIVDQLVSVT
NLLDTELLQIDTLKKQSESVGEMIIDKLKDYMSEEEAELDVQKQRVIVKQRLNHWVKEKH
QIIKYCFLIIEHALYILWSHLDFYMIQVISRHSRMQVSSGSIDEDTVTWKISSETLMELK
QGLVSTFTDSFITQLVNIHNKYALMEHKDKDSIESPGLQFVEALVRRIKRLLQFTFVE
NT seq 5757 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaaaaggaaccacacaggatatgtggacatcttataaagaattacagaat
cttgtagaacgatacattacttcttcttcaacaactcatgatcttcatgaatttacagaa
actttacgtaatcatagacaaaattttttaacacttttagaaaatcctcctccaaataag
aacagcagagaagaaataataaagggagctacagatggtattacacttcctgatttagga
catcagttattatcaaaagaattggttgatgaaactcttattatatcagatatgtataaa
cttaatgaatttatggcattagatcttttatgcactgctcagttgcaaatgccttatcat
cctagtttacccagaggattaacagctattttattatattatgatgggaaaaaagcactt
acatcaactttaagaatgcttgtacaagcaagaatgggacatagttggaaaattgatgct
tcacttgctcttttgagacatattacagaatatatgaataaattacaagatgatttatta
gatagaattttatcattgttagaaaaaatggatcctataaaggaacaagaactattggaa
aaaaatcgagccttaggtggaccaaaacatcgatatatggttatgaaactttataatgat
tctagacaagatttggcagacattttatatttgtggtctgcacaatcttcattaccaaat
tcaattttatttcgtttattatctctattacaaacaaaacaaattggaccagaagcctat
gaagaaggtccagataaggtcacacttgctattataatgagtgtgttaaatgcaatcaat
tttagttcattttctactcgtgagaatggtgaagaattgattaattctatgccattaatt
ttggaaagaggagcacatgaagaactatatcaaaaattaataacacctaatatcaattgg
gagtgtgctggattacgtgggattatacaatttgcttttgcagttgctcttacaacaata
aaaactgcagctaacatacaaatcttgaatattactacagaagatgagagattgttggaa
gcagctttaacaaataaatgttttcatttcatggcggaaatattatttaaaaacaaaagc
atatattatgaagaattttatcttcgttattttcattctcttatttctgattttatattg
ctaatgcctttaaaagttaaagatttacgaagtcgagcggatgaatctatgcgtttgatt
caggcgtatcaacaagagggtattgaaccgcctttaaatttagataatcattttgaatat
ttgatgttaacaatagcagaattatataaagaagatcctttaaaactgaagttagttaat
gactattggtgttataccgattccacgcatacatccgattctgcacatattaagcgttca
ctttctagagaagttgctctttttaaattcgtacgtctcgcaggtgaaatattaccagca
ggattatttgtgccatatcttaaaatgattgcatctcttgcatgttctccagaagcagca
aagcaagcatttagttttttaaagccaaatggatcttctggatcaacaacaatttcttgg
gatcactttttcaaatctttaagcctgtactatgataatcttagaactgaattgcctccc
agtcaagatactgtttaccgtcaaagaagccatcccaaaggcattacacctgaagaagtt
aaaggtcttgaagcagtattattggttgttcgagtgattgcgaaaaatgatatagaagat
agattaagaagagatatatattatcatccaggatggaaagtaataccatctttgataggt
ttagtcagttgtggaatatctattccattgaagagtgttttaataagaacacttgctgca
ttagtaatgtcatctgaaacttcattcactgtatggcaaagtttagaagctgcacaaata
gttccaaatataccaacaataagcagctatcaaccaagaggagttcaaactgaattagaa
gaaattgaatcaaaaaaagatgaatatccattaacgcgagcaatgcttgaacttttagat
gttctcactaactttcctatattacgattatcgggaatggggcaacgtaatcctggtttt
gatcaatatttgcgttttataattaatactgtttttctaaaatttcatacacgatcatat
aaaaatccaggagaaaaatgggaagtttcagaagcttgtttaaaaatatttttaaagctt
attaaacaatatgagcctgctgtagaagactttactggatgtaaagtagaacttcaaagt
ggagaagttacaatggtcaattctggttattacattatgactcaattacattccaaatct
gaattacttcatgttatattatatattcttgataaaggttgtactaatttcgatacttat
gaactctttcctggtaaaaagaatcttgaaaatagcactttgtattgtttggaaatatta
gaaagaggattaaatacgcaacataattatatggctcaatcagctgctgcaaaatctata
catacaattttgactggattatcaagattacttttagaagtggatccacaatcaaaaaga
cctgattatatgataaatattgctaaatatgtttcgtacagttcttggcttccgcaacat
gcatttcacgctgtcggtattatttatgaagtgactaatgaaccaggagcagattctgag
ttactttctatgtttacagctactcctgctttaactacgaatattcgacatggttttgtg
gaatgcttggatgcagatgaagatactgaaaatgaaaaacagtatactggtagttgcaaa
aatcggattttacttttaatgatgcaaagccttagaagacctactccaaatctttctcac
tatctattaggttttgaaatcactaaagatatcaaaaaaactgttttacaacaacccggt
attttaggatttcctcgtacatgtttacattcaatattaggaattttagagcaatctctt
gaacgtggtcgtgacaaaataacagaggcttgttattgtcttctttatatgttagctgaa
aacagcaaaacatttgtttcagttttaagatttttacgaactagtgcaaatcaagacttt
atacagagacatctttcaaaattaccatttgaaggatggaacacaataatagaacttggt
tgcatgtcatggttattgaaaatagccgcaattgaattacgagttgctggtggaagttca
cagaattctttaattcaacgattggttggaaactttggtcaagaaaaaggacaaattgta
ccatcacagaaacttctgatggatcttttgcattatattgaatttcagtttcaattggag
tcatctttatgtttagatttctttgatccatcacaagttgaaatggtttttgcacgatgt
agtgttcccgttacgttagtaggaggtcctcgacttatagaaattaaaaaattatattcc
attatcactgaggaattagctgttactcaaagtagtgcaattgctactcaacgtaatcct
atgcaagatgaagtacagaaaattttaaaatacgctttagaaagaaaccaaacaaaatta
ttatcttatgctacagtaaaatttctagaaggttggtgccaaacaacagaaatattattt
tgtgttgcaacaaatcaacaacttcctacacctcaaaaacagaatttattgttgaatcta
tcccatgatttattacaaaagatgacatcttgtgaagctttaagcgagattaaaacttta
gtatccggaacagtgctgatgttattagtacatttgcgaaacagtttcatcactcaaaca
gatagtgaatcatttccttcatcgccttcaaatgcaacaatgatgaaaattattttgagt
catattttgcaatggattataaacgcaggagcgtcttcacaaaaagtaattacccattta
tatgcggtattattgaattttctttgcgtagtcggtttagaaaaatcagaaaacacgaat
attattgatttaatgtacgttaatcaattagatagttcaatgaatagagtaatgcctatt
caggaacgttctcatcgatatgcaacgatacaagtgataaacagttttggaaataaattg
atggatattttatgtcataattgctcaggtggtcacgatgtatctaaaatgttggcatta
tcttgcttggataagatattagaattggattatgataatgcttggataatgtatttaacc
agtagaggatatttgaaacacatgatagaaagtcttttagaatctgataaaatgttacaa
aatatgttacatccagaacctcaaacattaagaccattatatttatatgaagcaaagatg
gcaacattttgcagaatggcctctacaagattaggtgctgaaagtcttttggagaataaa
attctatcgtgtatgtcaagtatgacagctttcaattaccatcctgatgttccattaggt
ttttcagtaagaaatcctcattcctttacaccttctcctggtcaacgttatcagcaaatc
cttttacctgctttgtatctttgtgatgctttgcttaccactcttggaacagagaatcaa
tcatgtgctatacaagtttgtggttttctacagagccatcgaggcattattgaaatggta
ctacgagatgcttatcaggaaccgaatgcacttattttgaaagaaatggcttgtcttaca
ggagtaatatcccgatctgcgaatattgatatgtataaattagtagatgaagaattggat
aaagctgattttgaattagaagacgttagtggtataagagaacttcgtgctcatctatat
cgattacaaagattaatgttggctctattgtataaattccaattacagccagctcctagc
tgtttaaatcacaagaatgtagaggaaaacgaaaaacatatttctcgtgtacaaatagtt
gcaaatattatgttatatacacgaaatcaaatgcagcataatagaatggatcaaaaaata
agaaacgtactttttgagcctcatttaactctaaaaccaagaggaagagaagatagaata
aaagacacatctggaggagtacatttaggaacgattgtcgatcaacttgtgtctgtcacg
aatttattagatactgaattacttcaaattgacactcttaaaaaacaatcggaaagcgtt
ggagaaatgattatagacaaattaaaagattacatgtccgaagaagaagcggaactcgat
gttcaaaagcaacgagttatagtgaaacaacgattgaatcattgggtaaaagaaaaacat
caaatcataaaatattgttttctaataatagaacatgcattgtatattctttggagtcac
ttggatttttatatgatacaagtgatatcacggcacagtcgaatgcaagtatcttcagga
agtatagatgaagatacagtgacatggaaaatatcttcagaaactttaatggaattaaag
caaggtcttgtttctacatttacagatagctttattacacaattagtaaatatacataat
aaatatgcattgatggaacacaaagataaagattccattgaaagcccaggtcttcaattt
gttgaagctcttgtcagaagaataaaaagattattacagttcacatttgtagaataa

DBGET integrated database retrieval system