KEGG   Apis mellifera (honey bee): 411920Help
Entry
411920            CDS       T01057                                 

Gene name
GB18053
Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG14
AA seq 502 aa AA seqDB search
MSDHGCIHLNNFKAAKGIQPYKVIHSYFVTSTSTEARIRKAVSCLCHTCKTYKDRLHSCL
HCIFFGCYVKGHIQEHAKTKKHFLAVDLCYGNILCFQCGDYVYDRELLGVAKAQWSESAK
SLSFGEFYRAWEPTQIEAELLRKHPRRRRVVENSTIGLRGLINLGSTCFMNCIVQALIHT
PLLRDYFLADRHHCPQPTRCLVCEVSHLFQEFYSGSKAPLTLHKLLHLIWTHARHLAGYE
QQDAHEFFIATLDVLHRHCEAAPILIKDNPHHCNCIIDQIFTGGLQSDVVCQACNGVSTT
IDPFWDISLDLGPAASASGSDSSGPPTSLLDCLERFTRAEHLGSSAKIKCSNCQTYQEST
KQLTMKQLPIVASFHLKRFEHSSIQDKKISTFISFPEQLDMTPFMSHRRNGNNNSAMIDG
LPKNGEDMAFSDNRYSLFAVINHEGSLETGHYTAFIRQQRDQWFKCDDHLITRARLKDVL
TSEGYLLFYHKQILEYGRNTKV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccatggctgcatacacttgaataatttcaaagcagccaagggtatccagccg
tacaaagtgatacactcctattttgtgaccagcacgtcgaccgaagcacgcataagaaag
gctgttagttgtttatgtcatacatgtaagacatataaagatcgcttacattcttgtctt
cattgtatattctttggctgctatgtaaaaggtcatatacaagaacatgcaaagacaaaa
aagcattttttagctgttgatctttgttatggaaatattttgtgcttccaatgtggagat
tatgtatatgatagagagctattaggagttgctaaagcacaatggagtgagtctgcaaaa
tcattgagttttggagaattttacagagcatgggaaccaacacaaatagaggcagaatta
ttaagaaaacatccacgcagaagacgtgtggtcgaaaattctaccataggtttaagagga
cttataaatcttggtagtacatgtttcatgaactgcattgtacaggcactcatacacacg
ccgctattaagagattatttccttgctgatcgtcatcactgcccacagccaacacgctgc
ctggtctgtgaagtgtctcatctttttcaggaattttattctggtagcaaagcgcctctg
acgcttcacaaacttctccatttaatctggacacatgcaagacatttagcaggttatgaa
caacaggatgctcatgaattctttattgctacactcgatgttctgcatagacattgtgaa
gcagcgccaatcttaataaaagataatccacatcactgtaattgtatcattgatcaaatc
tttactggtggacttcaaagtgatgtagtttgtcaagcatgcaatggagtatctacgacg
atagatccattttgggatatatctttggatttgggtccagcagctagtgcatcaggttcc
gatagttctggtcctcctacctcgttattagattgtttggaaaggttcactcgtgcagag
catttaggatctagcgcaaaaataaaatgtagtaattgtcagacgtatcaagaaagcact
aagcaattgacaatgaagcaactacctattgtggccagctttcacttaaaacgatttgag
cattctagtatacaggataagaagatttctacgttcatatcgtttccagaacaattagac
atgactccatttatgtctcatagacgaaatggtaacaataacagtgcaatgatagatgga
ctaccaaagaatggagaagacatggcattcagcgacaatagatattctctatttgcggta
ataaatcacgaaggttctttggagactggacactacactgcctttatacggcagcaaaga
gatcaatggtttaaatgtgacgatcatttaattacaagagcaagattaaaagacgtcttg
actagcgaagggtatctccttttttatcataaacaaattttggagtacggtcgaaatacc
aaggtgtaa

DBGET integrated database retrieval system