KEGG   Apis mellifera (honey bee): 411920Help
Entry
411920            CDS       T01057                                 

Gene name
GB18053
Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     411920 (GB18053)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   411920 (GB18053)
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     411920 (GB18053)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG14
AA seq 502 aa AA seqDB search
MSDHGCIHLNNFKAAKGIQPYKVIHSYFVTSTSTEARIRKAVSCLCHTCKTYKDRLHSCL
HCIFFGCYVKGHIQEHAKTKKHFLAVDLCYGNILCFQCGDYVYDRELLGVAKAQWSESAK
SLSFGEFYRAWEPTQIEAELLRKHPRRRRVVENSTIGLRGLINLGSTCFMNCIVQALIHT
PLLRDYFLADRHHCPQPTRCLVCEVSHLFQEFYSGSKAPLTLHKLLHLIWTHARHLAGYE
QQDAHEFFIATLDVLHRHCEAAPILIKDNPHHCNCIIDQIFTGGLQSDVVCQACNGVSTT
IDPFWDISLDLGPAASASGSDSSGPPTSLLDCLERFTRAEHLGSSAKIKCSNCQTYQEST
KQLTMKQLPIVASFHLKRFEHSSIQDKKISTFISFPEQLDMTPFMSHRRNGNNNSAMIDG
LPKNGEDMAFSDNRYSLFAVINHEGSLETGHYTAFIRQQRDQWFKCDDHLITRARLKDVL
TSEGYLLFYHKQILEYGRNTKV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccatggctgcatacacttgaataatttcaaagcagccaagggtatccagccg
tacaaagtgatacactcctattttgtgaccagcacgtcgaccgaagcacgcataagaaag
gctgttagttgtttatgtcatacatgtaagacatataaagatcgcttacattcttgtctt
cattgtatattctttggctgctatgtaaaaggtcatatacaagaacatgcaaagacaaaa
aagcattttttagctgttgatctttgttatggaaatattttgtgcttccaatgtggagat
tatgtatatgatagagagctattaggagttgctaaagcacaatggagtgagtctgcaaaa
tcattgagttttggagaattttacagagcatgggaaccaacacaaatagaggcagaatta
ttaagaaaacatccacgcagaagacgtgtggtcgaaaattctaccataggtttaagagga
cttataaatcttggtagtacatgtttcatgaactgcattgtacaggcactcatacacacg
ccgctattaagagattatttccttgctgatcgtcatcactgcccacagccaacacgctgc
ctggtctgtgaagtgtctcatctttttcaggaattttattctggtagcaaagcgcctctg
acgcttcacaaacttctccatttaatctggacacatgcaagacatttagcaggttatgaa
caacaggatgctcatgaattctttattgctacactcgatgttctgcatagacattgtgaa
gcagcgccaatcttaataaaagataatccacatcactgtaattgtatcattgatcaaatc
tttactggtggacttcaaagtgatgtagtttgtcaagcatgcaatggagtatctacgacg
atagatccattttgggatatatctttggatttgggtccagcagctagtgcatcaggttcc
gatagttctggtcctcctacctcgttattagattgtttggaaaggttcactcgtgcagag
catttaggatctagcgcaaaaataaaatgtagtaattgtcagacgtatcaagaaagcact
aagcaattgacaatgaagcaactacctattgtggccagctttcacttaaaacgatttgag
cattctagtatacaggataagaagatttctacgttcatatcgtttccagaacaattagac
atgactccatttatgtctcatagacgaaatggtaacaataacagtgcaatgatagatgga
ctaccaaagaatggagaagacatggcattcagcgacaatagatattctctatttgcggta
ataaatcacgaaggttctttggagactggacactacactgcctttatacggcagcaaaga
gatcaatggtttaaatgtgacgatcatttaattacaagagcaagattaaaagacgtcttg
actagcgaagggtatctccttttttatcataaacaaattttggagtacggtcgaaatacc
aaggtgtaa

DBGET integrated database retrieval system