KEGG   Apis mellifera (honey bee): 411920Help
Entry
411920            CDS       T01057                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     411920
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   411920
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     411920
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    411920
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     411920
    SLIK complex
     411920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 489 aa AA seqDB search
MNLKMAAVYNYSVGIKFCQIYNSRKVTAVSCLCHTCKTYKDRLHSCLHCIFFGCYVKGHI
QEHAKTKKHFLAVDLCYGNILCFQCGDYVYDRELLGVAKAQWSESAKSLSFGEFYRAWEP
TQIEAELLRKHPRRRRVVENSTIGLRGLINLGSTCFMNCIVQALIHTPLLRDYFLADRHH
CPQPTRCLVCEVSHLFQEFYSGSKAPLTLHKLLHLIWTHARHLAGYEQQDAHEFFIATLD
VLHRHCEAAPILIKDNPHHCNCIIDQIFTGGLQSDVVCQACNGVSTTIDPFWDISLDLGP
AASASGSDSSGPPTSLLDCLERFTRAEHLGSSAKIKCSNCQTYQESTKQLTMKQLPIVAS
FHLKRFEHSSIQDKKISTFISFPEQLDMTPFMSHRRNGNNNSAMIDGLPKNGEDMAFSDN
RYSLFAVINHEGSLETGHYTAFIRQQRDQWFKCDDHLITRARLKDVLTSEGYLLFYHKQI
LEYGRNTKV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaaatggccgccgtatacaattactctgtcggtataaagttttgccagatt
tataactcacgtaaagtaacggctgttagttgtttatgtcatacatgtaagacatataaa
gatcgcttacattcttgtcttcattgtatattctttggctgctatgtaaaaggtcatata
caagaacatgcaaagacaaaaaagcattttttagctgttgatctttgttatggaaatatt
ttgtgcttccaatgtggagattatgtatatgatagagagctattaggagttgctaaagca
caatggagtgagtctgcaaaatcattgagttttggagaattttacagagcatgggaacca
acacaaatagaggcagaattattaagaaaacatccacgcagaagacgtgtggtcgaaaat
tctaccataggtttaagaggacttataaatcttggtagtacatgtttcatgaactgcatt
gtacaggcactcatacacacgccgctattaagagattatttccttgctgatcgtcatcac
tgcccacagccaacacgctgcctggtctgtgaagtgtctcatctttttcaggaattttat
tctggtagcaaagcgcctctgacgcttcacaaacttctccatttaatctggacacatgca
agacatttagcaggttatgaacaacaggatgctcatgaattctttattgctacactcgat
gttctgcatagacattgtgaagcagcgccaatcttaataaaagataatccacatcactgt
aattgtatcattgatcaaatctttactggtggacttcaaagtgatgtagtttgtcaagca
tgcaatggagtatctacgacgatagatccattttgggatatatctttggatttgggtcca
gcagctagtgcatcaggttccgatagttctggtcctcctacctcgttattagattgtttg
gaaaggttcactcgtgcagagcatttaggatctagcgcaaaaataaaatgtagtaattgt
cagacgtatcaagaaagcactaagcaattgacaatgaagcaactacctattgtggccagc
tttcacttaaaacgatttgagcattctagtatacaggataagaagatttctacgttcata
tcgtttccagaacaattagacatgactccatttatgtctcatagacgaaatggtaacaat
aacagtgcaatgatagatggactaccaaagaatggagaagacatggcattcagcgacaat
agatattctctatttgcggtaataaatcacgaaggttctttggagactggacactacact
gcctttatacggcagcaaagagatcaatggtttaaatgtgacgatcatttaattacaaga
gcaagattaaaagacgtcttgactagcgaagggtatctccttttttatcataaacaaatt
ttggagtacggtcgaaataccaaggtgtaa

DBGET integrated database retrieval system