KEGG   Apis mellifera (honey bee): 411927Help
Entry
411927            CDS       T01057                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     411927
Peptidases [BR:ame01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   411927
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   411927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
Position
LG1
AA seq 348 aa AA seqDB search
MVHWLPKKCFKKRYLFWIMKVSIFTYLVIFGLLPIIFHYSYAFQKKILFLNFVQWPLNVD
FSKPESVGMKGTRNFYLKTDEEVKIGLWQILPQSLLNDSTITTANDYEAVLKNAKQPIFL
YMHGNSGNRASSHRLELYKLFQNLDYHVICFDYRGYGDSEEAELSEMGVVNDSKYVLEWL
LKIVNGTTPVFVWGHSLGTGVSTHVLALLAIKKVQPAGLFLESPFNNIADELSEHPLAQI
FKHLPWFHWIIVEPFYDNFLRFESDKHVEKIQCPIMILHAEDDNIIPFALGEKLFKAAIN
YHGNNTNSIQMTRIDALYGLGHKYICRYKNLPNVIKSFVAKAHKNQTE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtacattggttaccaaaaaaatgttttaaaaagagatatttattttggattatgaag
gtatcaatatttacatatcttgttatatttggacttttacctattatatttcattattct
tatgctttccaaaaaaagattcttttcttaaattttgttcaatggccacttaatgtagat
ttttcaaaaccagaatcagttggaatgaaaggaacaagaaatttttatttaaaaactgat
gaagaagtgaaaataggattatggcaaatactacctcaatctttattaaatgattccact
attacaactgctaatgattatgaagctgtattaaaaaatgctaaacaacctatttttctt
tatatgcatggtaatagtggtaatagagcaagtagtcatcgtttagaattatataaactt
tttcagaatttagattatcatgttatatgttttgattacagaggctatggtgatagtgaa
gaagcagaactttctgaaatgggggttgttaatgatagtaaatatgtacttgaatggcta
ttaaaaatagtaaatggtacaacccctgtttttgtatggggacattcattaggaactgga
gtatctactcatgtattggcattattagcaataaaaaaagttcaacctgcaggtttgttc
ttagaatcaccatttaataatatagcggatgaattaagtgaacatcctttagcacagata
ttcaaacatttaccatggtttcattggataattgttgaaccattttatgataattttctt
cgttttgaatctgataaacatgtagaaaaaattcaatgtcctattatgatattgcatgca
gaagatgataatatcattccatttgctttaggtgaaaagttgtttaaagcagcaataaat
tatcatggaaataatacaaatagcattcaaatgacaagaattgatgcattatatggcctt
ggacataaatatatatgtcgttataaaaatttgcctaatgtaatcaaatcatttgtagct
aaagcacataaaaatcagactgaataa

DBGET integrated database retrieval system