KEGG   Apis mellifera (honey bee): 411981Help
Entry
411981            CDS       T01057                                 

Gene name
faf, GB10029
Definition
fat facets
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     411981 (faf)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   411981 (faf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 2588 aa AA seqDB search
MTIATRGQGVGIDPPDSQQSTQMHSPPGPQQLADTMSGLQLTENVVQTECTNDTLTSIED
SNQLHGEPDFPVAKLNMLHEKISSPRWVVPVLPEQELECLLQASIDLCKKGIDVQSEACQ
RFFREGLTISFTKILTDDAVSSWKMNIQNCINANCERLVDLCILKLDEDWFPLLDLLAMV
FNPSNKFHTFNAARVSETVPPGSDIPDEQLYARPPPDSRSPRGWLVDLINRFGSLNGFEI
LLSRFQNGRNLTVPVIYALIRPFGLCYELLTVHTIVKYLMPIVEMVPVILNNLTDEELKK
EAKNESKNDAISAIIKAAKCLVSRVPHQEEMIKNLGILRLKMILRLLQISSFNGKMNALN
EVNKVIATVSFYQHRNAIVEEEEWLTAECMAKWIKENGVLEIVLRDSLHQPQYVEKLEKI
LRFIIKERALTLEDLDAVWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFECFQMSW
KTANKKQGEKLLELIRRLAEDDKDGVMAHKVLTLFWNLAHSDEVPTEIMDQALNAHVKIL
DYSCSQERDAQKTIWLDKCVEELKNSDKWALPALKQIREICCLYEPNPNIACHGQRNHHY
RQDVIERLQAEHSAVILVTNSLTNYMDKMRQLVKENPDIDANIYMHDGRYNHIMQVQERL
NFLRFLLKDGQLWLCADQAEQIWQCLAEQGVFVSDREACFKWFSKLMGDEPDLDPAINKD
FFQNNILQLDPTLLTESGIKCYERFFKAVNSKEGKLKLKRRTFLMDDVDLIGTDYLWRVV
TNSPEEIANRAIELLKEVNTNLGPRLQSSVLAFHVTYIGECMDRLKAHYDTVSVLSKVYL
EGKEEREQQMSNKIKIEAMKMCRVMKVLQEYINECDTTFPGERKILPLHRAVRGKHLSFI
IRFANPGRNVDDIEIFTHSNDTLGSLRRQILRRIKANGSNVKLDLFLNGEPLESTDDRKL
LSQTPLRDKMLLSAKLSQVNSNLPSSPDSSSDSSTSSPHHPYDGPDIEAENSLPGVVISQ
RSQYATFFFQLADLGCSLQHAQLRDGARNLLQLVPPDTLTVSRLQSLFGHCKDDNNLDNA
LCNEQNTTVDSLFFTASSSQVLYNLEVLYSLLMPVLDPMSERAFEFQCNFIKSGEAGVIL
EMLTKNKFLPNADETTKRAAYLTVLKLCKLLLTTVGNVMACVMDEMQQAGISENHDNHVH
NNRGPVAVLKQALQSVPNQNTEYMLRSVATNLAQHLALRMLCGAAEFDKCRQLFMQALSW
ELPDVATIRAIIRLAWAASTGNLNNINASAEMLHTLHEINEKETSNNPDNNDVLVCKEAL
EVLTIALVLNPTALESLSRDKMWHTFLIDLVLLSTSRVVRMAAAEQFFLISTWYSSGHQP
LLFAITLLFTVLNTTVMEHAKQSHEYFQLLCRLLNFAHMSGCPLLTAETLLNIEIAWLKK
VRDNVKETGESQVDEAVLEGHLSLTKELLSFLPPSKKYELGSDEKHGVNLIKELVEDFVF
PASRLMLQLRSTGELSASQASPVCTTPQSTSAAFDLLVGLCVGCVPNMKLLVTMLTDMFY
SERDEPLVEWDYLPPVGLRPLKGFVGLKNAGATCYMNSVLQQLYMVESIRVGLLAAEGAA
IDLNEDFSGEERIEGEQTIETNDNDTNEEKCGADESRKEYNIGILKQVQAIFGHLAYSKL
QYYIPRGLWKHFKLQGEPVNLREQQDAVEFFMSLVESLDEALKALGHEQIMSKILGGSYS
DQKICKGCPHRYSKEEPFSLISVDIRNHSNLLDSLEQYVKGELLEGADAYHCDKCNKKVV
TVKRLCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRDLDMEPYTVSGLAKLEGEV
IDCDYEESMKGTCTKYQLTGIVVHSGQASGGHYYSYILHRQNDGVAKWYKFDDGDVTECK
MEEEEEMKSQCFGGDYLGEVFDHMLKRMSYRKQKRWWNAYMLFYTRLDVEENSLMKSVNE
LSLYTKLGVMKMPSAIEYSVRKQNIKFMHNRNQFSAEYFQFIKKLVSCNPHNINRQNMNE
KLSPEQEELAMLSVQLASRFLFYTGFHTKKTLRGNATDWYDIVCHHLRSSKSVRSWFAHN
VLFNHPHRFCEYLLSCPSTEVRTAFLKILVFLAHISLLDGPCVPPSLNAPTILLDPTATL
SDHLLHAVLSLLHREISDHGRHLPHYFSLFHTYASLGLAEKAQLLKLNVPVTFMLVAIDE
GPGPTIKYQYPELTKLHQVVSMLIRCCDVSSKAHSSLAQSGVVPLSNPYGDPACQNEYLM
PIQPQAADILFVKNSYMKKLIEDADVNVTEDTVKLLQYCCWENPHVSRTVLSELLWQIGF
SFAHEIKHHTDLLLAVLLMEDSWQTHRVHNALKGVPDEREGLFEIIQRSKHHYQKRGYQC
IKCMVQLFSKCRPAHQLLHHSSELKRKWIHATDWLHEELDKRPYTSAAPYTHAYSNWSPP
AQSNDSANGYVLERSNSAKKTLERACELCPDEEQEVEDTSEDCTEETEKYQPQNRDILRS
RRSLVWGCIGYPDVTVIQQMQEEQQSQPRPSPVHTPLWSQSPVILTPPAHQLHSPQNCES
SQNTSQDP
NT seq 7767 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgccacaagaggccaaggagtaggcatagaccctcctgacagccagcaaagt
acacagatgcatagtccaccgggtccgcaacaattagctgatacaatgtcaggacttcaa
ctcacggaaaatgtggtacaaacagaatgcaccaatgataccttaacttcaatagaggat
agtaatcaacttcatggcgaacccgattttcctgttgcaaaactcaatatgcttcatgaa
aaaatatctagtccacgatgggttgtaccagttctaccagaacaagaattagagtgcctg
ttacaagccagtatcgatctttgtaaaaaaggaattgatgtacaaagtgaagcatgtcag
cgcttttttcgagaaggactcactatttcttttactaaaatattgactgatgatgcagta
agtagttggaaaatgaatattcaaaattgtattaatgcaaactgcgagcgattggtggat
ctatgtattctgaaactagatgaggattggtttcctcttcttgatttgctggcaatggtt
tttaatcctagtaataaatttcatacatttaatgcagcaagagtttcagaaactgtgcca
ccgggtagtgatatccctgatgaacagctttatgcccggccacctcctgattcaagaagt
cctcgtggatggctagtagatctcataaatagatttggcagtcttaatggatttgaaatt
ttactctccagatttcaaaatggccgaaatttaacagtaccagttatttatgctttaatc
agacctttcggtttatgttatgaactacttactgttcacacaatagttaaatatcttatg
cctattgtggaaatggtgcctgtaattttgaataacttaaccgatgaagaattaaaaaaa
gaagcgaaaaatgaatcaaaaaatgatgcaatatcagctataatcaaagccgccaaatgt
ttagtatcacgagtaccacatcaagaagagatgattaaaaatttaggaattctgagattg
aaaatgatattgagactcttgcaaatttcttcatttaatggaaaaatgaatgctttaaat
gaagtaaataaagtgattgctactgttagtttttatcaacatcgaaatgcgatagttgaa
gaagaagaatggcttactgcagaatgtatggcgaaatggataaaagaaaatggagtttta
gaaattgttttaagagattcgttacatcaacctcaatatgttgaaaaattggaaaagatt
ttacgctttattataaaagaacgagcattaactttagaagatttagatgctgtttgggca
gcacaagctggaaaacatgaagcaattgtgaaaaatgttcatgacttattagccaaactt
gcttgggattttagtcctgaacaacttgaccatttatttgaatgttttcagatgagttgg
aagactgctaataaaaaacaaggagaaaaattattagaattaattcgcagattagcagag
gatgataaggatggagtaatggcacataaagttttaactcttttttggaatttggctcat
tctgatgaagtgcctactgaaataatggatcaagcattaaatgctcatgtaaagattctt
gattattcgtgttcacaagaaagagatgctcaaaagacaatttggctggataaatgcgtg
gaagaattaaaaaatagtgataaatgggctttacctgcattaaaacaaattcgggaaata
tgctgcctttatgaaccaaatcctaatatagcatgtcatggacaacggaatcatcattat
agacaagatgttatagaacgacttcaagcagaacattctgcagtaattcttgtgacgaac
agtttaacaaactatatggataaaatgcgacagttggtgaaagaaaatccagatattgac
gcaaatatttatatgcatgatggtcgttataaccatattatgcaagtccaagaaagactt
aattttcttcgttttttgttaaaggatggtcaactatggttatgtgcagatcaagctgaa
caaatttggcaatgtttagcagaacaaggtgtatttgtatccgatcgtgaagcatgtttc
aaatggttttcaaaattaatgggagatgaaccagatcttgacccagcaataaataaagac
ttcttccaaaataatatattacaattagatccaactttacttacggaaagtggtattaaa
tgctatgaaagatttttcaaagctgtcaattctaaagaaggaaaattaaaattgaaaaga
agaacatttcttatggatgacgttgacctaattggtacagattatttatggcgtgttgtg
accaatagtcctgaagaaattgcaaatcgagctatagaattattaaaagaagtgaatact
aatttaggaccacgacttcagtcatcagttttggcatttcatgtgacatatataggagaa
tgtatggacagattgaaagctcattatgatactgtatccgtattaagtaaagtatatctt
gaaggaaaagaagaacgtgagcagcaaatgtcaaataaaattaaaatagaagctatgaag
atgtgtcgtgttatgaaggtattacaagaatatataaatgaatgtgatacaacatttcca
ggagaacggaaaatattaccattacatagagcagttcgtgggaagcatctatcttttatc
attcgttttgcgaatcctggtcgtaatgtggatgatatagaaatatttacacatagtaat
gacactttaggatcattaaggcgacaaatattacgcagaattaaagccaatggatcaaat
gtaaaacttgatttatttcttaatggagaacctttagaatcaacagatgatagaaaacta
ctttctcaaactccattaagagataaaatgctattgtctgcgaaattaagtcaagttaat
agcaatttgccaagttcaccagatagtagttcagatagttctactagttctccacatcat
ccatatgatgggccagatatagaagcagaaaatagtttacctggtgtggttatatcacaa
agatcgcagtatgctacattcttctttcaattggcagatcttggatgtagtcttcaacac
gcgcaattacgcgatggtgcaagaaatttattacaattggtgccaccagatactcttact
gtatcacgattacaatcattattcggtcactgtaaagatgataacaatttagataatgct
ctttgtaatgaacaaaatactacagtagattctttattttttactgcaagttctagccaa
gttttatacaatttagaggttttatatagtttattaatgccagttttagatccaatgtca
gaaagagcatttgagtttcagtgtaatttcataaagagtggcgaagctggtgttattctt
gaaatgttaactaaaaataaatttttaccaaatgcagatgaaactacgaaacgagcagca
tatttaacagttttaaaattatgtaaacttctattaacgacagtgggtaatgtgatggct
tgtgtaatggatgaaatgcagcaagctggaatttcagaaaatcacgataatcatgttcac
aataatcgaggtccagtagcagttttaaaacaagccttacaaagtgtacctaatcagaat
actgaatatatgttgagaagtgtagcaacgaatttggcgcaacatttagcgcttcgaatg
ttgtgtggagcagcagaatttgacaaatgtcgacaactttttatgcaagctctttcctgg
gagttaccagatgtagctactattcgtgccataattaggctagcatgggcggcatccaca
ggtaatttaaacaatataaatgcatctgctgaaatgcttcatacacttcatgaaataaac
gaaaaggaaacatcaaataatcctgacaataatgatgtgttagtatgtaaagaagcatta
gaagttctgacaatcgctttggtattgaatccaactgcattagaatcattatcaagagat
aaaatgtggcatacatttttgatagatcttgtgctcttgagtacatcaagagtagttaga
atggctgcggctgaacaattttttcttatatcgacatggtatagtagtggtcatcaacca
ttactttttgcaataacattacttttcactgttttgaacactactgttatggaacatgca
aaacaaagtcacgaatattttcagcttttatgtagattgttaaattttgcacatatgtcg
ggatgtcctctcttgacagctgaaacattattgaacattgaaatagcatggctaaaaaaa
gtacgggacaatgttaaagaaactggagaaagtcaagttgatgaagccgttctcgaaggt
caccttagtcttactaaagaattactttcttttttacctccaagtaaaaaatacgaactt
ggctctgatgaaaaacatggagtaaatttgattaaagaattggttgaagattttgtattt
cctgcatctcgtcttatgttgcaacttcgtagcactggagaactgagtgcttcgcaagcg
agcccagtatgcacgactcctcaatcgactagcgccgcatttgatttacttgtaggtctt
tgtgtaggctgtgtacctaacatgaaacttctagtcacaatgctcactgatatgttctac
tctgaaagagatgaaccgctagtagaatgggattacttaccacccgtcgggcttaggcca
ttaaaaggttttgtaggtttgaaaaacgctggcgcaacttgttatatgaattcagtatta
caacaattgtatatggttgagagtataagagttggacttttggctgcagaaggtgcagcg
atagatttgaacgaagatttttctggagaagaaagaattgaaggagaacaaacgatagaa
acaaatgataatgatacaaatgaagaaaaatgtggagcagatgaatctcgaaaagaatat
aatattggtattttaaagcaagttcaagcaatttttggtcatttagcatatagtaaatta
caatattatatacctagaggactttggaaacattttaaactgcaaggtgaacctgtaaat
cttagagaacaacaagatgcagtagaattttttatgagcttagtggaaagtttagatgag
gcattaaaagccttaggacatgaacaaataatgagcaaaattctgggtggttcatacagt
gatcagaaaatctgcaaaggttgccctcatagatattccaaggaggaaccatttagtttg
ataagcgtggatataaggaatcatagtaatttattggactctcttgaacaatatgtaaaa
ggagaattattagagggtgcagacgcttatcattgcgacaaatgtaataaaaaggttgtg
acggtaaaacgattgtgtgtaaagaagttaccacctgttttagccatacaattaaaaaga
tttgaatatgactatgaaagggtttgcgccataaaatttaacgattattttgaatttcca
cgagatttggatatggaaccttatactgtttctggactcgcaaaattggagggagaagtt
atagactgtgattatgaagagtcaatgaaaggaacttgtactaagtatcaattaactggc
attgtagtacatagtggtcaagctagtggtggtcattattattcatatattttacatagg
caaaatgatggtgttgcgaaatggtataagtttgatgacggtgacgttacggaatgtaaa
atggaagaagaagaagaaatgaaatctcaatgttttggtggtgattatttaggagaagta
tttgaccatatgcttaaaagaatgagttaccgaaaacaaaagcgatggtggaatgcttat
atgttattttataccagattagatgtagaagaaaattctttaatgaaaagtgttaacgaa
ttatcattgtatacgaaactaggagttatgaaaatgccctcagctattgaatatagtgtc
agaaaacaaaatatcaaatttatgcataatcgaaatcaatttagtgcagaatattttcaa
tttattaaaaaacttgtatcttgtaatcctcataacatcaatagacaaaatatgaatgaa
aaacttagcccagaacaggaggaactcgcaatgttatctgtacaattagcatcaagattt
ctgttttatacaggttttcatactaagaaaactttacgcggtaatgcaacagattggtat
gatatcgtttgccatcatttacgtagcagcaaatcagtgcgatcttggtttgctcataat
gttctatttaatcatcctcatagattttgcgaatatcttttgagttgtcccagtacagaa
gttcgaacagcttttcttaaaatattggtatttcttgcacatatttctctcttagatgga
ccgtgcgtaccgcctagtctaaatgcaccaactatacttttggatccaacagcaacgctt
agtgatcatttattacacgcagttctttctttacttcatcgtgaaatctcggatcatgga
cgccatctaccacattatttctcactatttcatacgtatgcatcgcttggtcttgcagaa
aaagctcaattgcttaagttaaatgtccccgttacatttatgctggttgcaattgatgaa
ggacccggtcctacgataaaatatcagtatcctgaattaacaaaattgcatcaagtagtt
agtatgttgatacgttgttgtgatgtatcatcaaaagcacactcgagtcttgcacaatca
ggagtagtacctttatcaaatccatatggtgatccagcatgtcaaaatgaatatttgatg
cctattcaaccacaagcagcagatatactcttcgttaaaaacagttatatgaaaaaatta
atcgaagatgcagatgttaatgttactgaagatacagtaaaattattgcaatattgttgt
tgggagaatcctcacgtatctcgaactgttctcagtgaattgttatggcagattggattt
tcttttgcacatgaaataaaacatcatactgacttattacttgctgtacttcttatggaa
gattcatggcaaacacatcgtgttcataatgctctaaaaggtgtaccagatgaaagagaa
ggtttatttgagataatacaaagaagtaaacatcattatcagaaaagaggatatcagtgt
attaaatgtatggtgcaactttttagtaaatgcagacctgcacatcaacttttacatcat
agttcggaattgaaaagaaaatggatacatgctaccgactggcttcatgaagaactcgat
aaaagaccttatacttctgcagcaccatatacccatgcatatagtaattggtctccacca
gctcaatctaatgattctgcgaatggttatgttttggaacgtagtaacagtgcaaagaaa
acattagaaagggcatgcgaactctgtcccgatgaagaacaggaagtggaagacacaagc
gaggattgtacggaagaaacagaaaagtatcaaccacaaaacagagatatattgcgatcg
agacgtagtttagtctggggatgtataggttatcctgatgttactgtaatacaacaaatg
caagaagaacaacaatctcaacctagaccatctccagttcatactcctctttggtcccaa
tctccagttatactcacaccaccagctcatcagttacatagtccacaaaactgtgagtca
tcacaaaataccagccaggatccataa

DBGET integrated database retrieval system