KEGG   Apis mellifera (honey bee): 411985Help
Entry
411985            CDS       T01057                                 

Gene name
GB15744
Definition
uncharacterized LOC411985
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ame00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 1503 aa AA seqDB search
MNGMERHGHGHGHSHTHSHRHRHSHGNLQSVSQNSSQSSKHSHTHALHLQKDTPVIQTPQ
KPRNYKLLVDPFLVKGATKLYRYDGMVPGDPTYPEVQPRDPRSQLTRIWTRLEQLDLPVP
RFKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIAR
VVFETTKASKACVEKLNNTSVMGKVLKVFLDAFGEECKKIYDELTTEKKPEKKIEKEIKS
ENEQGKQTPIEKMISEERDDFRSNKKLISTVEKSRDTYIENSRYNKYRDYPTPSGSAGSD
LGYGTAPSELNYSSNYSQNSTPATNYDFYYSNYHHQPPNNYLANMPQNVSQNLSMQQNSN
IWWGNNTGTANYASSSMWPVQHGTNLDNPNSNTIQISKTSNVKIHHIPKKEKENQNVTKN
SSRDSPIETRKTLDLDTRIAMLLKDKAGGMAPPFLQFGSDSEDEKKSVNADNEMLSEPPS
PFLSLETYKSCFEKIRERNKERWKVHENSINQFSVDEDLGSVISSSEDEALLGSYSPAPD
EIEPEPPKDPPPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPTSQLYPGAGYPGHLTHYP
ASDMYHWPRPAQYPYPYGTTYLQSHYQPNTTSFSGTVGNHQGANYYPSFQSRLHAMANHN
ITKDNPQGPTINGVLNRVVNELKQILKKDFNKKMIENTAFKLFEVWWDEKKSEKSRNQEG
ENTTVNNSNKEESQKPQGLSLLLEQGTPLGFNYDGFGLGIRASMPKMPSFRRKIKAPSPL
PQDEDSRQSDHADTELIGSDSDLDLASVQKVKRPITSLPSVSSSSSSSSASSESSSEEMS
CSESSNSSSDSSDEEVCSGNFEDEQDTDSHLSDHQPLACNSEDPDILTELAIQRSLDCPT
PTGRETPIPNIKIKDVNSNEFPQCDDEASPVLSPLEYESDKEDNEKIDDKSVDKEYLENI
RIVNEDIETKNVEDEVQKKIKNTSIASGKQESCDIQKMENSAAEALITLAGQDNIIRHRS
PGPVQPNIIRALQTMSAKYINDEPILKESEKIEMFSEIPTTDSEEESLEIRRLRYQAEAD
LRLNSQQSPKNSQASQVFMEHSYSLPPTQSEIAKSVLRTPSAPIKPVKLKSSKIVKLSKN
KDKTHKVEKRKYNKYTKMRVHQNHEGEKENIENEYVYEKYPKKVEEPIVTYKERDLMSEM
AILYEFLTRGIDAEDVEYLRRSYEALLADDSQGYWLNDTHWVDHPPTDIPSPAKRRKRDE
LRLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVEDNNGSYASGDGTMNGPKNNT
KALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFA
MEPIAADEMVIEYVGQMVRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARF
INHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRG
TLN
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaatggagagacatgggcatggacatggacattcacatacacactcacatcgt
catcgtcattcacatggaaatttacaaagtgtatctcaaaattcaagtcaatcatcaaaa
catagccatacccatgcattacatttgcaaaaagatacacctgtaattcaaacacctcaa
aaaccaagaaattataaactattagttgatccattcttggtaaaaggtgcaacaaagtta
tatagatatgatggcatggttccaggagatccaacttatcctgaagttcaacctagagat
ccaagatcacaattaacaagaatttggactcgtttagaacaacttgacttacctgtacct
agatttaaaattgactctaattattgtggtgaaccccctccgcttgaagtgacattttgt
catttaaatgacaatattgataaaacttttttatcagacatggttcaaaaatttggagct
gtagaagaactcattgtttattatcatcctgtaactaataaacatcttggaattgcaaga
gtagtgtttgaaactacaaaagcttcaaaagcttgtgttgaaaaattaaataatacatct
gtgatgggtaaagttttaaaagtatttcttgatgcatttggagaagagtgtaaaaaaatt
tatgatgaattaactacagaaaaaaagccagaaaagaaaatagagaaagaaataaaatcc
gaaaatgaacaaggaaaacaaactccaattgaaaaaatgattagtgaagaaagagatgat
ttcagaagtaataagaaattgatatccactgtagaaaaatcaagagatacatatatagaa
aattcaagatacaataaatatagagattatcctactcctagtggcagtgcaggaagtgat
ttaggctatggtactgcacctagtgaactaaattattctagtaattattctcaaaattct
actccagctacaaattatgatttttattatagtaattatcatcatcaacctccaaataat
tatttagcaaatatgccacaaaatgtatcgcaaaatctttcaatgcagcaaaattcaaac
atatggtggggaaataatacaggaacagcaaattatgcatcatcttctatgtggcctgtt
caacatgggacaaatttagataatcctaattctaatacaattcaaatttctaagacttct
aatgtaaaaatacatcatatacctaaaaaagaaaaagaaaatcaaaatgttacaaaaaat
tcatcgcgagattcaccaatagaaactcgtaaaacattagatttggatactagaattgct
atgttattgaaagacaaagcagggggaatggcaccaccttttttgcagtttggtagtgat
tctgaagatgaaaaaaaatctgttaatgcagataatgaaatgctttcagaaccaccaagt
ccttttctatctcttgaaacatataaatcatgttttgaaaaaattagagaaaggaataaa
gaacgatggaaagtgcatgaaaatagcattaatcaattctctgttgatgaagatttagga
agtgttataagttcaagtgaagatgaagcattattgggtagttatagtcctgcaccagat
gaaattgaaccagaaccaccaaaagatccaccacctcctcctccgcctgatgatgataga
atgtcattaagtccattaagttcaggggatgaaaaaattgaagaggttatagctcaaaca
gaacccacgagtcagttatatccaggagctggttatcctggacatttaactcattatcca
gccagtgatatgtatcattggccaagaccagcacaatatccatatccctatggaacaaca
tatttacaaagtcattatcaaccaaatactacatcattttctggaacagtaggaaatcat
caaggagcaaattattatccatcttttcaatcaagacttcatgctatggcaaatcacaat
attacaaaagataatccacaaggtcctactattaatggcgtattaaacagagttgtaaat
gaattaaaacaaattctaaaaaaagattttaataaaaaaatgattgaaaatacggcattt
aaactgtttgaagtatggtgggatgaaaagaagtcggagaaaagtcgaaatcaagaagga
gaaaataccactgttaataacagtaataaagaagaaagtcaaaaacctcaaggattatca
ttactgttggaacaaggaactccacttggatttaattatgatggatttggtttgggcatt
agagctagcatgccaaagatgccttctttcaggcgcaaaattaaagctccaagcccatta
ccacaagatgaagatagtcgtcaatctgatcatgctgatacagaactcataggaagcgat
agtgatcttgacttagcatcagtgcaaaaagttaaaaggccaattacttctcttcctagt
gtttcttcatcgtcttcctcatcatctgcatcgagtgagagtagtagtgaggaaatgagt
tgcagtgaatcttctaatagttcaagtgatagttctgatgaagaagtatgttctggaaat
tttgaagatgagcaagacacagacagccatttgtcagatcatcaacccttggcttgcaac
agtgaagatcctgatattttaacagaacttgcaattcaaagatcattagactgtccaact
cctactggtagagagacaccaatacctaacattaaaataaaagatgtaaattcaaatgaa
tttccacaatgtgatgatgaagctagccctgtattatctccattggagtatgaaagtgat
aaagaagataatgaaaaaatagatgataaatctgtggataaagaatatcttgaaaacatt
cgaatagtcaatgaagatatagaaacaaagaatgtggaagatgaagtacaaaaaaaaata
aaaaatacttcaatagcatcaggtaaacaagaatcatgtgatatacaaaaaatggaaaat
tctgcagcagaagctttaataacattagctggccaagataatattataagacatagaagt
ccgggacctgtacaaccaaatattattagagctcttcaaactatgtctgctaagtatatt
aacgatgaacctatattaaaagaatcggaaaaaattgaaatgtttagtgaaatacctact
accgattcggaggaagaaagcttagaaattagaagattacggtatcaggctgaagctgat
cttcgactcaatagccaacaaagtccaaaaaattcacaagcttcacaagtatttatggaa
cattcatattcattgccaccaacacaatcagaaattgcaaaatctgtacttcgtacgcct
tcagcaccaataaaacctgtaaaacttaaatcctcaaaaattgtaaaattatctaagaac
aaagacaaaacacataaagtagagaaacgaaaatacaataaatatactaaaatgcgtgtt
catcaaaatcatgaaggagagaaagaaaatatcgaaaatgaatatgtttatgagaaatat
ccaaaaaaagttgaggaaccaatagttacatacaaagaacgtgatcttatgtcggaaatg
gctattttgtatgaatttttaactagaggaatagacgcagaggatgtggaatatttaaga
cgaagttacgaagctttattagctgatgatagtcaaggttattggttaaatgatacacac
tgggtcgatcatcctccaactgatattccaagtcctgcaaaacgaagaaaaagagatgaa
cttagattgcatacaagcggaagtgcaagaacggaaggatattataaagttgatgtacgt
gaaaaagctaagcataagcatcattatgcgcaaagtatacaacgaagcaatgacgttgaa
gataataatggctcttatgcctctggtgatggaacaatgaatggtccaaagaacaatact
aaagctttaactggtaaaatgcaagctttatctcgcgaagctcgaagtaatcaacgtcgg
ttattaacagctttcggtatcgatactgatagcgaccttcttaaatttaatcagttgaaa
tttagaaaaaaacaattgaaatttgctaaatctggtatacatgattggggtttatttgct
atggaaccaattgcagctgatgaaatggttatcgaatatgttggtcaaatggttagacca
gttgttgctgatttacgagagtctcaatacgaagctaccggtatcggtagttcttatctt
ttccgcattgatttagatacaattattgatgcaacaaagtgtggaaatttagcacgattt
attaatcatagctgcaatccgaattgttatgcaaaagtaattacaattgagagccagaag
aaaattgtaatctatagtaaacaaccaataggagttaacgaagaaattacatatgattat
aaatttccattggaggatgataaaatcccttgcctatgtggagctcctcaatgtcggggt
actctcaattaa

DBGET integrated database retrieval system