KEGG   Apis mellifera (honey bee): 412010Help
Entry
412010            CDS       T01057                                 

Gene name
Tfb2, GB10106
Definition
general transcription factor IIH, polypeptide 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ame  Apis mellifera (honey bee)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    412010 (Tfb2)
  Replication and repair
   03420 Nucleotide excision repair
    412010 (Tfb2)
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     412010 (Tfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG2
AA seq 409 aa AA seqDB search
MSNTISGKNLLRPTGLQCKNLQEYLKSRPSEVLNKLYHNPPICLAVFRELPVIAKHYVMR
LLFVEQPVPQAVIASWCSKLHFEEHQKVVLVLNELNVWNEASIPGGLPGWILNTTFKKNL
KIVLLGGGKPWTMSNQLETDSKPRDVAFLDSYALERWECVLHYMVGSQQQEGISADAVRI
LLHAGLMKRDEADGSPVITQAGFQFLLLETASQVWYFILQYLDTIEARGLDLVECLTFLF
QLNFSTLGKDYSTEGMSEGLLTFLQHLREFGLVYQRKRKAGRFPNLVVSILTRDSVRQAL
KSGITATQIVGYLQQHAHSKMIEAGPPILPPTIVDQIKLWENERNRFIFSEGVLYSQFLS
QTDFEVLRDHALSTGVLIWQSERKRTMVVTKAGHDDVKKFWKRYSKGSS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacaataagtggaaaaaatttgttaagacctactggattgcaatgtaaaaat
cttcaagaatatttaaaatcacgtccatcagaagtattaaataaattatatcataatcct
ccaatttgtttggctgtttttcgtgaattgccagtaatagcaaaacattatgttatgaga
ttattatttgttgaacaaccagttcctcaagcagtcattgcttcttggtgttccaagctt
cattttgaagaacatcaaaaagtagttctagtacttaatgaattaaatgtgtggaatgaa
gcatcaataccaggtggacttcctggatggattctaaatacaacattcaagaaaaactta
aaaattgttcttttgggcggtggaaaaccatggacaatgtcaaaccaattagaaactgat
agcaaacctagagatgttgcatttttagattcatatgcactagaaaggtgggaatgtgta
ttacattatatggttggttcacagcaacaagaaggtatatctgctgatgctgttagaatt
cttttacatgctggattaatgaagcgagatgaagctgatggaagtccagttattacacaa
gcaggttttcaatttttattattggaaactgcatcacaggtgtggtattttattttacaa
tatttagatacaatagaagcaagaggacttgatttggttgaatgtcttacttttttattc
caattaaatttttcaacacttggtaaagattatagtactgaaggaatgtctgaaggttta
ttaacatttttgcaacatttaagagagtttggtctcgtttatcaaaggaaacgaaaagca
ggaagatttccaaatttagttgtatcaatattaacaagagattctgtacgtcaagcctta
aaaagtggaattactgctacgcaaattgttggttatttgcagcaacatgctcatagtaaa
atgatagaggcaggtcctccaattttacctcctactatagtagatcaaattaaattgtgg
gaaaatgaaaggaatagatttatatttagcgaaggagttttgtacagtcaatttctttct
caaactgattttgaagtacttagagatcatgctctttctactggagtattaatttggcaa
agtgaaagaaaacggacaatggtagttacaaaagcaggacatgatgatgtaaaaaaattt
tggaaacgatattctaaaggttccagttaa

DBGET integrated database retrieval system