KEGG   Apis mellifera (honey bee): 412069Help
Entry
412069            CDS       T01057                                 

Gene name
UGP, GB11461
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ame  Apis mellifera (honey bee)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    412069 (UGP)
   00052 Galactose metabolism
    412069 (UGP)
   00500 Starch and sucrose metabolism
    412069 (UGP)
   00520 Amino sugar and nucleotide sugar metabolism
    412069 (UGP)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     412069 (UGP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 513 aa AA seqDB search
MHDFSKLDGDDGSLKRFMKRKDTQAFRERTKRDALNELQHELEKLEATATGDIKEEIHRQ
FDGFTHLFRRFLQEEGPSLEWDRIQKLPDDAIRDYNSLPTPEGEELKTLLSKLIVIKLNG
GLGTSMGCHGPKSVIAVRNGLTFLDLTVQQIEYLNKTYNANVPLILMNSFNTDDDTQRII
RKYKGIDVNIQTFNQSCYPRINRDSLLPTAKHCDIADDIEAWYPPGHGDFYESFRNSGLL
KKFIKEGREYCFISNIDNLGATVDFKILKLLLDKREASPLEFVMEVTDKTRADVKGGTLI
KYEDKLRLLEIAQVPKDHVDDFKSVKTFKFFNTNNLWIKLSAIERVLEKNSLNMEIIVNN
KTFSNGSNIIQLETAVGAAMKSFEGSIGINVPRSRFLPVKKTSDLMLVMSNLYTLRNGSL
VMSPQRMFPTTPLIKLGDNHFAKVKEFLTRFPAIPDLLELDHLTVSGDVTFGKGVTLKGT
VIIIANHGERIDLPSGTILENKIVSGNLRILNH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatttctcgaaattggatggtgacgatggcagcctgaagcggtttatgaagaga
aaagatacgcaggcattccgcgaaaggactaagagagatgccctaaacgagcttcagcat
gaattagagaaacttgaggcaaccgcgacaggggatatcaaggaggaaattcatcggcag
ttcgatggctttactcatctctttcgacgattcctccaagaagaaggaccttcgttggaa
tgggatcgtatacaaaaattgcctgacgatgcgataagagattataattccttgccaact
ccagaaggagaagaactgaaaactcttttaagcaagttaatcgttataaaactaaacggt
ggcttaggaactagtatgggatgccatggtccaaaatctgtaatagcagtacgcaatgga
cttacgttccttgatctgacggtacaacaaattgagtatttaaacaaaacttataatgct
aatgttccgctcattttgatgaattctttcaatacggatgatgatacacaacgaattatc
agaaaatacaagggaatagatgttaatattcaaacgtttaatcaaagttgctatcctcgc
atcaatagagattctttacttccaactgcaaaacactgcgatattgcagatgatattgaa
gcatggtatcctcctggtcatggagatttttatgaaagttttcgaaattcaggtttatta
aaaaaatttataaaagagggacgtgaatattgttttatttcaaacattgataatttaggt
gctactgtagatttcaaaattttgaaattattattagataaacgtgaagcttcacctctt
gaatttgttatggaagttactgataaaactcgagctgatgttaagggtggtacattaatt
aaatatgaagataaactacgtttacttgaaattgctcaagttccaaaggatcatgtagat
gatttcaaatcagtaaaaacattcaagtttttcaacacaaataatttatggataaaactt
agcgctattgaaagggtacttgaaaagaattctttgaacatggaaattattgtcaataat
aagactttttcaaatggttcaaatatcattcaattagaaacagctgttggagcagctatg
aaatcatttgaaggaagcattggtataaatgtccctcggagtagatttttaccagtgaaa
aaaacttcagacttaatgcttgttatgagcaatttatacactctccgcaatggttcatta
gtaatgagtcctcaacgaatgttccctaccacacctcttataaaattaggtgataatcat
ttcgcaaaggtcaaagaatttcttactagatttccagcaattccagatcttttggaattg
gatcatttaacagtatctggagatgttacttttggaaaaggtgtaactcttaaaggaact
gttataattattgcaaatcatggagagcgtattgatcttccatcaggcacaattttagaa
aataaaatagtctctgggaatttacgtatattgaatcattaa

DBGET integrated database retrieval system