KEGG   Apis mellifera (honey bee): 412114Help
Entry
412114            CDS       T01057                                 

Gene name
GB19771
Definition
ubiquitin carboxyl-terminal hydrolase 38-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     412114 (GB19771)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   412114 (GB19771)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 878 aa AA seqDB search
MNTEQILKYDIKQCLNLIITGKNADVIEGWTRLQKLESEPIYGQLNNYESILREILNDEI
KNVQEVSKIMIWFSKYLMEKPFTVHPISNDIATMLRNTEISDMSHLTMILQVLLEHSVYL
PESVSHSKLCEAIVISLSTFVMPCDPKKISEFNDNATKVQNFLKIVRSKSKNIENDNLIF
ICLQTLYRIISDTKQKQDPGPGLAAVLQVVEPSIIPQAVNWILSESHSDAQLTQALKVLC
SWLPKWIGDRLSIWIMEFILGLEKRHKYSILIEVTKAKIDVMFRALSVPVFRQNASTIIF
YILKRQGSPTLFQSIIRNTQIVISFFLMKEDSESSKECIQNLVDIMKILTLRFSNQRVCN
NLESSFPVQPRMHIIKEIWNEHVWIDEMEEIEPIIESPKTHLGKVGLSNLGNTCYMNSVL
QALLMTKQFCYEVLMYKPLNKTDDQIVLKKLQNLFALLLYSKRISLAPTEVLLASRPAYF
LPGQQQDSSEFLCHLLDLLHEQEKSSTINGEANTNLKYKDDREINDISSISEEGASIKRW
TTEEDLSGSIVLERKTQSLADFTHGEDLAQVQELSDSHSDSTDSGIQSVGGEDTSTQVPL
VHRVLGGKCKITYQCAQCDTSSDNTDKFRDLQLCFPEEIQENQEVSVQDLINYYLTPEKL
TGENKYRCDKCMKLCDAQRIIKILHAPTYLILILKHFRYDFDTRLRTKLRHKVMYNETIQ
LPVSTSLCTTTENYQLYAAVVHSGYSMDYGHYFTYARDSKQNWYKFNDSYVSQTTFNDFK
DLKPPDTPYILFYEKTVPFEGLYDEDKPELLTLNKHLQELVANDTTAYIEELRHQAEKSQ
RGRHNSILFRKNENSDDENPPPSNCRGAVNMPASRFLY
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaacaaattcttaagtacgacatcaaacaatgtttaaatttaataataact
ggtaaaaatgcagatgttattgaaggatggaccagacttcaaaaattagaaagtgagccc
atatatgggcaattaaataattatgaaagtattttacgagaaatactcaatgatgaaata
aaaaatgtacaagaagtttcaaaaattatgatttggttttcaaaatatttgatggaaaaa
ccatttactgttcatccaatttcaaatgatatagcaacaatgttaagaaatacagaaatc
agtgatatgtctcatttgacaatgatacttcaagtattattagaacacagtgtatattta
ccagaatctgtgagtcattcaaaactttgtgaagcaattgttattagtttgtctactttt
gtaatgccatgtgatccaaaaaagatttcagaattcaatgataatgctacaaaagtacaa
aactttttaaaaatagtaagatcaaaatctaagaacattgaaaatgataatttaattttc
atatgtttgcaaacattatatagaataatatctgatactaaacaaaaacaagatcctgga
cctggtttagctgctgtattacaagtagtagaaccttctattataccacaagctgttaat
tggattctttctgaatcacattctgatgcccaattaactcaagctttaaaagttttatgt
agttggcttccaaaatggataggtgatcgattaagtatttggattatggagtttatactt
ggattagaaaaaagacataaatattcaatacttattgaagttacaaaagcaaagattgat
gtaatgtttcgtgctttatctgtacctgtatttcgtcaaaatgcttccacaattatattt
tatatattaaaaagacaaggatctccaaccttgtttcaaagtataataagaaacacacaa
atagtgatatctttttttctaatgaaagaagattctgaatctagcaaggaatgcatacaa
aatttagttgatattatgaaaatacttacattaagattttcaaatcaacgtgtttgcaat
aatttagaaagtagctttccagttcaaccacgaatgcacattattaaagaaatatggaat
gaacatgtttggatagatgaaatggaagaaattgaaccaataattgaatctccaaaaaca
catttgggaaaagttggactttcaaatcttggaaatacatgttatatgaatagtgtatta
caagcattgttaatgactaaacaattttgttatgaagtattaatgtacaaacctttaaac
aaaactgatgatcaaattgtacttaaaaagttgcaaaatctatttgctttgttattatat
tcaaaaagaatttccttggcaccaactgaagttttattagcttcacgtcctgcttatttt
ctaccgggtcaacaacaagatagctcagaatttctctgtcatcttttagatcttttacat
gagcaagaaaaatcaagtactataaatggtgaagctaatactaatcttaaatataaggat
gatagagaaataaatgatatttcatcaataagtgaggaaggagctagtattaaacgttgg
actactgaagaagatttaagtggaagtattgtattagaaagaaaaacacaatcattagca
gattttactcatggtgaagatttagcacaagtacaggaacttagtgattcacattcggat
tctacagatagtggaatacaatctgtaggtggagaagatacaagtactcaagtacctctt
gtgcatagagtattaggaggaaaatgtaaaattacttatcaatgtgctcaatgtgatact
agttctgataatactgataaatttcgcgatttacaattatgtttcccagaagagattcaa
gaaaatcaggaagtttctgttcaagatcttataaattattatcttacaccagaaaaatta
actggtgaaaataaatatcgttgcgataaatgtatgaagttatgcgatgcacaaagaatt
ataaaaattttgcatgcacctacatatttaattttaatattgaaacattttcgttacgat
tttgatacaagattaagaacaaaattacgacacaaggtgatgtataatgaaactatacaa
ttaccagtatcaacatcattatgcacaactacagaaaattatcagttatatgcagctgtt
gttcattcgggttatagtatggactatggtcattatttcacttacgctcgcgattcgaaa
caaaattggtataaatttaatgatagttatgtctcacaaacgacatttaacgattttaag
gatttaaaaccaccagacacgccttatatattgttttatgaaaaaactgtgccatttgaa
ggactttatgatgaagataaacccgaattattaacattaaataaacatttacaagaacta
gtggcaaatgatactacagcttatattgaggaattgagacatcaagctgaaaaatctcaa
cgcggacggcataattcaatattatttcgaaagaatgagaattctgatgatgaaaatcct
ccacctagtaactgtcggggtgcagttaatatgcctgcgagtcgtttcctctattaa

DBGET integrated database retrieval system