KEGG   Apis mellifera (honey bee): 412209Help
Entry
412209            CDS       T01057                                 

Gene name
CYP6AS4, GB15793
Definition
cytochrome P450 6AS4
Orthology
K14999  
cytochrome P450, family 6 [EC:1.14.-.-]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.-  Acting on paired donors with incorporation of molecular oxygen
    1.14.-.-  
     412209 (CYP6AS4)
Cytochrome P450 [BR:ame00199]
 Cytochrome P450, animal type
  CYP6 family
   412209 (CYP6AS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 501 aa AA seqDB search
MLHHFHILTAFVAIFLALYYYLTSKFDFWKNRGVSGPRPVPFFGNAKDVLLRKIGIGSFI
AELYKRYDNEAMFGIFIGRSPNLVLRDLDLIKDVLIKDFSIFDNRGLNIPERAEPFSVNL
FSVDATRWRPLRMRLSPVFTSGKLKEMFPLILECAEHLEQCLEDAVKRGGPVDCFEIPAR
YTTDVIGSCAFGINMNALSDERSEFRKMGRNMFDQNMIKFTRNLLRDFFPRFYNLLGFVL
PYTESTVFMTKLIKGTIKYREENDVVRPDFVNLLMELKKHPEKLKNIEITDTLLAAQASV
FFAAGFETSSTTMAHALYEMALNPDIQDKLRNEMKEFHAKNNGNLKYEDIKEMKYLDKVF
RETLRKYPPGMLLRRKCNSNYTFHGTKVSIPAGTSVIIPLYAIQIDPKFYENPDVFDPER
FNEDAVAARHPMTYLPFGDGPRNCVGARFAVYQTKVGLIKILQNFRVDVCEKTMIPYVKK
INSITLAPRDGIFLKIEKITD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctccatcattttcatatattaaccgcatttgtcgcgatttttctcgctttatattat
tacctcacgtcgaagtttgatttttggaaaaatcgtggcgtgagtggacccaggcctgta
ccattctttggaaacgccaaagatgttctgctacgaaaaattggaattggcagcttcatc
gcggaactctataagagatacgacaacgaggcaatgttcgggatattcatcggcagatca
cctaatctcgttttgcgcgatcttgaccttatcaaggatgttttaattaaagatttctct
atatttgataatcgaggattaaatattcccgaacgagccgaacctttttccgtaaatttg
ttcagcgtagacgctacaagatggcgaccattaagaatgagattgtcaccggtatttacc
tctggtaaactgaaggaaatgttccccctgatattggaatgcgccgaacacttggagcaa
tgtttggaggatgctgtgaaaagaggtggtcctgtcgattgctttgaaataccagctaga
tacacgacagatgttatagggagttgcgctttcggaatcaacatgaacgcgttgtcggac
gagcgtagtgaattccgcaaaatggggcgaaacatgttcgatcaaaatatgatcaagttt
acgaggaatttacttcgagatttctttccacgtttctacaatttgcttggcttcgtatta
ccgtacacggaatcaaccgtgttcatgaccaagctaatcaagggaacgatcaaatacagg
gaagagaacgacgtcgtgaggccagattttgtaaatttgttgatggaattgaagaagcat
ccggaaaaattaaagaatattgaaataacggatactttacttgccgctcaagcttccgtt
ttcttcgcggctggatttgaaacgtcatcgacgacaatggcacacgctctttacgaaatg
gcactgaatcctgacatacaagataaattacgaaacgaaatgaaagaattccacgcgaag
aataatgggaatctgaaatacgaggatatcaaagaaatgaaatatttggacaaagtattt
agagaaacacttagaaagtatccaccaggaatgcttctgaggcgaaaatgcaactctaat
tataccttccatggtacaaaagtatcgatacccgctggtacttctgtaattattcctctg
tatgcaattcaaatagatccaaaattttatgaaaatccagacgtgttcgatcctgaaaga
tttaacgaggatgcagtagctgcaaggcatccaatgacctatttaccatttggtgatgga
ccaaggaattgcgttggagcacgatttgccgtttatcaaacaaaagttggattgataaaa
atactgcaaaattttagagtagacgtttgcgaaaagacgatgattccttatgtaaagaag
ataaattcaattacattggcacctagagatggaattttcttgaagatagaaaaaataact
gattaa

DBGET integrated database retrieval system