KEGG   Apis mellifera (honey bee): 412271Help
Entry
412271            CDS       T01057                                 

Gene name
Stk6
Definition
(RefSeq) serine/threonine-protein kinase Aurora-2
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     412271 (Stk6)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   412271 (Stk6)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     412271 (Stk6)
Chromosome [BR:ame03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    412271 (Stk6)
   Spindle formation proteins
    412271 (Stk6)
  Sister chromatid separation proteins
   Aurora kinases
    412271 (Stk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG14
AA seq 389 aa AA seqDB search
MLKDQRRTISQVENNFKQLKISKVAPVLTENTLKNTENLDTIKNQCSTYVTNIKQNKENN
SKMSTELMPPPKLPPVSSKTTERIPNATDDEKENKIVNNLDIEKNLEQNITNNKKQTDKK
WVLTDFDIGRPLGKGKFGNVYLAREKKSKFIIAMKVLFKAQIQKADVEHQVRREIEIQTH
LRHPNILKMYGYFHDDKRIYLILEYAPNGELFKELNAQPEKRFDEIRTATYISQLADALK
YCHSKKVIHRDIKPENLLLGIKGELKVADFGWSVHAPSSRRNTLCGTLDYLPPEMINGNT
HDHTVDLWGLGVLCYECLVGIPPFLAKSYNETYMKIRKAQYTFPEFLSEGAKDLISKLLI
VDPGQRLPLEDVLRHPWIVQNRTTEPHVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaggatcaaagaagaacaatttcacaagtagaaaacaattttaaacaattaaag
atatcaaaagtggctcctgtattaactgaaaatacattgaaaaatacagaaaatttagat
actataaaaaatcaatgcagtacttatgtaacaaatattaaacaaaataaagaaaacaat
tctaaaatgtctacagaattgatgccaccacctaaattaccacctgtatcttctaaaaca
acagaacgtataccaaatgcaactgatgatgagaaagaaaataaaattgtcaataatcta
gacattgaaaagaatctggaacaaaatattacaaataataagaaacaaactgataagaaa
tgggtattaactgattttgatattggtcgacctttaggaaaaggaaaatttggaaatgtt
tatttagctagagaaaagaaatcaaaattcattattgctatgaaagtattgtttaaagca
caaatacaaaaagccgatgttgaacatcaagttagaagagaaatagaaattcagacacac
ttaaggcatccaaatattttaaaaatgtatggttattttcatgatgataaaagaatatat
ttaattttggaatatgccccaaatggagaattattcaaggaattgaatgctcaacctgag
aaacgttttgatgaaattagaacagcaacatatatatctcaattagcagatgctttaaaa
tattgtcatagtaaaaaagtgatacatcgtgatattaaacctgaaaatttattacttggt
ataaagggcgaattaaaagtagcagattttggatggtctgttcatgctccttcctctaga
agaaatactctttgtggtactttagattatttaccaccagaaatgattaatggaaacaca
catgatcatactgtagatttatggggacttggtgttctttgttatgaatgtttagtaggc
atacctccatttttagctaaatcttataatgaaacatatatgaaaattaggaaagctcaa
tatacatttccagaatttttaagtgaaggtgctaaggatttaatatctaaattattaata
gttgatccaggtcaaagattacctttagaagatgttttaagacatccttggattgtgcaa
aatcgaacaacagaaccacatgtatcataa

DBGET integrated database retrieval system