KEGG   Apis mellifera (honey bee): 412271Help
Entry
412271            CDS       T01057                                 

Gene name
Stk6, GB14418
Definition
serine/threonine protein kinase 6
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     412271 (Stk6)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   412271 (Stk6)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     412271 (Stk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 389 aa AA seqDB search
MLKDQRRTISQVENNFKQLKISKVAPVLTENTLKNTENLDTIKNQCSTYVTNIKQNKENN
SKMSTELMPPPKLPPVSSKTTERIPNATDDEKENKIVNNLDIEKNLEQNITNNKKQTDKK
WVLTDFDIGRPLGKGKFGNVYLAREKKSKFIIAMKVLFKAQIQKADVEHQVRREIEIQTH
LRHPNILKMYGYFHDDKRIYLILEYAPNGELFKELNAQPEKRFDEIRTATYISQLADALK
YCHSKKVIHRDIKPENLLLGIKGELKVADFGWSVHAPSSRRNTLCGTLDYLPPEMINGNT
HDHTVDLWGLGVLCYECLVGIPPFLAKSYNETYMKIRKAQYTFPEFLSEGAKDLISKLLI
VDPGQRLPLEDVLRHPWIVQNRTTEPHVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaggatcaaagaagaacaatttcacaagtagaaaacaattttaaacaattaaag
atatcaaaagtggctcctgtattaactgaaaatacattgaaaaatacagaaaatttagat
actataaaaaatcaatgcagtacttatgtaacaaatattaaacaaaataaagaaaacaat
tctaaaatgtctacagaattgatgccaccacctaaattaccacctgtatcttctaaaaca
acagaacgtataccaaatgcaactgatgatgagaaagaaaataaaattgtcaataatcta
gacattgaaaagaatctggaacaaaatattacaaataataagaaacaaactgataagaaa
tgggtattaactgattttgatattggtcgacctttaggaaaaggaaaatttggaaatgtt
tatttagctagagaaaagaaatcaaaattcattattgctatgaaagtattgtttaaagca
caaatacaaaaagccgatgttgaacatcaagttagaagagaaatagaaattcagacacac
ttaaggcatccaaatattttaaaaatgtatggttattttcatgatgataaaagaatatat
ttaattttggaatatgccccaaatggagaattattcaaggaattgaatgctcaacctgag
aaacgttttgatgaaattagaacagcaacatatatatctcaattagcagatgctttaaaa
tattgtcatagtaaaaaagtgatacatcgtgatattaaacctgaaaatttattacttggt
ataaagggcgaattaaaagtagcagattttggatggtctgttcatgctccttcctctaga
agaaatactctttgtggtactttagattatttaccaccagaaatgattaatggaaacaca
catgatcatactgtagatttatggggacttggtgttctttgttatgaatgtttagtaggc
atacctccatttttagctaaatcttataatgaaacatatatgaaaattaggaaagctcaa
tatacatttccagaatttttaagtgaaggtgctaaggatttaatatctaaattattaata
gttgatccaggtcaaagattacctttagaagatgttttaagacatccttggattgtgcaa
aatcgaacaacagaaccacatgtatcataa

DBGET integrated database retrieval system