KEGG   Apis mellifera (honey bee): 412350Help
Entry
412350            CDS       T01057                                 

Gene name
Hdac3, GB14923, HD3
Definition
histone deacetylase 3
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     412350 (Hdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 433 aa AA seqDB search
MSYNKKVSYFYNPDVGNFHYGPGHPMKPHRLAVIHSLVLNYGLHKKMQIYRPYRASTHDM
CRFHSDEYVEFLQRVTPQNLQGYTKYLSHFNVGDDCPVFEGLFDFCSMYTGASLEGATKL
NNNCCDIAINWSGGLHHAKKFEASGFCYINDIVIAILELLKYHARVLYIDIDVHHGDGVQ
EAFYLTDRVMTVSFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDTSYVQVFKP
VISHVMEFFQPTAIVLQCGADSLANDRLGCFSLSTKGHGECVKFVRDLNVPLLTVGGGGY
TLRNVARCWTYETSLLVDEQISNELPYTEYLEYFAPDFTLHPDVVTRQDNANSKQYLEAI
TRHVYDNLKMIQHSPSVQMQDVPCDALSPEEERQPEPDLDSRQNVQDTDKIIEPANEYYS
GEKDQDKMDVSET
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaacaaaaaagtatcatacttttataatccagacgttggaaattttcattat
ggccctggacatcctatgaaaccccatagactcgctgtaatacatagtttggtactcaat
tacggtctacataaaaaaatgcaaatctatcgtccatatcgtgctagtactcatgatatg
tgtcgctttcattcagacgaatatgttgaatttttacaaagagtgactccacaaaactta
caaggatacaccaaatatttaagtcactttaatgtaggcgatgattgtccagtttttgaa
ggactgtttgatttttgttctatgtatacaggcgcttctttagaaggtgctacaaaacta
aacaataattgctgtgatattgctattaattggagtggaggattacatcatgcaaaaaaa
tttgaagcttccggtttttgttatattaacgatattgttatagcaattttggaattgtta
aaatatcatgctagagtactttacatagatatagatgtccatcatggagatggagtgcaa
gaagcattttatcttacagatagagtaatgacagtatcttttcataaatatggaaattac
ttttttcctggtactggagacatgtatgaaattggagcagaaagtgggagatattactct
gttaatgtacctttgaaagagggtatagatgatacatcttatgttcaagtattcaaacca
gtcatatctcatgtaatggaatttttccaaccgacagcaatagttttacaatgtggtgca
gattcacttgcaaatgatcgtcttggttgctttagtttaagtacaaaaggacatggagaa
tgtgtaaaattcgttagagatttgaatgtaccactgctcactgttggaggaggaggatat
acattacgtaatgttgcgcgttgttggacttacgaaacttctttgcttgttgatgaacag
attagtaacgagttaccatacacagaatatttagaatattttgcaccagattttacattg
catcctgatgttgtaacaagacaagataatgcaaatagtaaacaatatttagaagctatt
acgagacatgtatacgataatttgaaaatgattcaacactctccaagtgttcaaatgcaa
gatgttccatgcgatgcattgtctcctgaagaagaaagacaaccagaacctgatctagat
tctagacaaaatgtacaagatactgataaaataattgaaccagcaaatgagtactattct
ggagaaaaagatcaagataaaatggatgtaagcgaaacatga

DBGET integrated database retrieval system