KEGG   Apis mellifera (honey bee): 412355Help
Entry
412355            CDS       T01057                                 

Gene name
GB16108
Definition
diacylglycerol kinase eta-like
Orthology
K00901  
diacylglycerol kinase (ATP dependent) [EC:2.7.1.107]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ame00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ame00564]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ame04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 1378 aa AA seqDB search
MSPKQQRTHSRFKVITPFRSLVLCGESRQEMEDWLNALRTVTKNCAQTDSGIAEMLSGNH
QWYATSHARPTYCNVCRDALYGKKECNNYFIGSDEAWEAIRPTGCSPLLVFVNSKSGDNQ
GIKFLRRFKQLLNPAQVFDLIKGGPGPGLRLFRHFDPFRILVCSGDGSVGWVLSEIDRLG
MHKQCQVGVLPLGTGNDLARVLGWGSSCDDDAHLPQLLEKYEKAGTKMLDRWSIMTFERS
ISLPCPKNVLNHPDTVQKSNIASQYEENILTHITNVLESDQENVILSSIRILCDTVKDFV
AYIMENMNSEDQQVEEKCKILQQKLNLFLTILCKEEEYLSTEHINDVDNINLNTEISVSP
DNCEKGVLEKPEKDITNLKKVQKRKQFADKEIVMSRANSLKRTVRKFVEYAQLVIDDQIN
INSKHGIKIANTNSSLDDSTIINSILSKKKQLNIPGLKVDHVESLSVETLIESVKSTDNS
ICTSPTPNVASLSPIPDLRRDSQPEEILTLPAPDGFADSRRNSENLPQGSFNFHTSMIPC
MDNEQETEILESNDQQISDSNNIEISSEFQVSVTRTTFDTSSPSEDGTTQDISSDIDSIQ
SPEHEQKSENKAKMEVLKGYIGSDTFDSEIRHIDSPDNSEMITSELQNSESLIGQDLTSI
INGEEYDSVREYLENELENTDITNEIAKRSFKKSTKYSTVIEMENKFKYKIGSTEQNVNK
ANKFKEQDGKASDLLRPVCCFTVSSDTTPTNEKRNSFPPTISVIINPPSPSMSIESQHDL
DAEYKMNPYLRRHTDESMERLSVELPELGFSPQATRRISSGSLLKASEVVSLAATAARFG
GSNASLRHERVKSVDKTEDVKKLPIINPLVQLPMWPNVSGGTGLISQALLANADALCAAV
SPLMDPDETLMEGYFERCVMNNYFGIGIDAKISLDFHHKREEHPEKCRSRAKNYMWYGVL
GSKQWLQKTYKNLEQRVQLECDGQRIPLPSLQGIVVLNIPSFMGGTNFWGGTKEGDLFLA
PSFDDRILEVVAVFGSVQMAASRLINLQHHRIAQCQTVQINILGDEGVPIQVDGEAWIQP
PGIIRIIHKNRMQMLYRNRALETSLKTWEEKQRSTLNAISQSISTLSTTQLQSQSKLLQV
HNKPTHLNEEEMYILLGFIEVVTTLVKWVKLLIISHPSLEPDLYQVAARTAQALEQVHPD
GKILQGINLRPVVTELVSSARQLYEDSCELLRDKAHNLKLREDLENKLSFSLASMEQELK
KCTFDEGGTRLVYLQNLPSDEQGDKKNRHRGLFWLKFRRSGINSGTNLARDQVTTWGVQE
VCCWLENLQLGEYTEKFISHDIRGRELLSLARRDLKELGIIKVGHVKRILQAINDLNN
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaaagcaacaaagaacccattctcgattcaaggtgataactccatttcgatca
ttagttctttgtggtgaaagtagacaagaaatggaagattggttgaatgcattaagaaca
gtaacaaagaattgcgctcagacagattctggaattgcagaaatgcttagtggtaatcat
caatggtatgcaacaagtcatgcgagaccaacatattgtaatgtttgtagagatgctctt
tatggtaaaaaagaatgtaataattattttataggtagtgatgaagcttgggaagctata
agacctactggatgcagtccacttttagtatttgtaaatagtaaatctggtgacaatcaa
ggtattaaatttcttagaagatttaaacaattattaaatccagcacaagtatttgatctt
ataaaaggaggaccaggaccagggttaagactatttcgtcattttgatccatttcgtatt
ttggtatgcagtggggatggatctgttggttgggttctttctgaaattgatcgtctagga
atgcataagcagtgtcaagttggagttctaccattgggaacaggaaatgatttggcacgt
gttttgggttggggatcttcttgtgatgatgatgctcatttacctcagttattagaaaaa
tatgaaaaagcaggcacaaaaatgcttgatcgatggagtattatgacttttgaacgtagt
atttctttgccatgtcccaaaaatgttttaaatcatcctgatactgtacaaaaatcaaat
attgctagtcaatatgaagagaatattcttacccatataacaaatgttttggaatcagat
caagaaaatgtaattttatctagtattagaattttatgtgatacagtaaaagattttgta
gcatatataatggaaaatatgaactcagaggaccaacaagtggaagaaaaatgtaaaata
cttcagcaaaaacttaatttgttcttaacaatattatgcaaagaagaagaatatctatca
actgaacatataaatgatgttgataatattaatttaaatactgaaatttctgtttcacct
gataattgtgaaaaaggagtattagaaaagccagagaaagatataacaaatttaaaaaaa
gtgcaaaaaagaaaacaatttgcagataaagaaattgtcatgtcaagagcaaacagttta
aaaagaactgtaagaaaatttgtagaatatgctcaattggttatagatgatcaaattaat
atcaactcaaaacatggtattaaaatagcaaatacaaatagttcattagatgatagtaca
ataataaattcaatattgagcaaaaaaaaacaattaaatattcctggtttaaaagtagat
catgttgaaagtttatctgtagaaacactaatagaatctgtaaaaagtacagataattca
atatgtactagtccaactcctaatgtagcatctttaagtcctataccagatcttagaaga
gattctcaacctgaagagatattaacattacctgctcctgatggttttgctgatagtaga
cgaaatagtgaaaatttaccacaaggttcgtttaactttcatacctctatgattccttgt
atggataatgaacaagaaacggaaatacttgaatctaatgaccaacaaatatctgattcc
aataatatagaaatttcttcagaatttcaagttagtgttacaagaaccacttttgataca
agttcaccttcagaagatggaactacacaagacatttcatctgatatagattcaatccaa
tcaccagaacatgaacaaaaatcagaaaataaagctaaaatggaagtacttaaaggatat
ataggtagtgatacatttgattccgaaattagacatattgattctcctgataattcagaa
atgatcactagtgaattacaaaattctgaaagcttaataggacaagatttaactagtatt
ataaatggagaagaatatgattctgtaagagagtatttagaaaatgaattagaaaatact
gatattacaaatgaaattgctaaacgctcatttaagaaatcaacaaaatattctactgtt
atagaaatggagaataaatttaaatacaaaattggatcaacagaacaaaatgtaaacaag
gcaaataaatttaaagagcaagatggtaaggcatctgatttattgcgccctgtatgttgc
tttactgtatcttcggatactactccaacaaatgaaaaacgtaatagctttccacccaca
ataagtgttataatcaatcctcccagtccatcaatgtcaattgaaagtcaacatgattta
gatgcagaatataaaatgaatccttatttaagacgacatactgacgaaagtatggaaaga
ttaagtgtggaactacctgaattgggtttttctcctcaagcaactcgtcgaattagtagt
ggaagtttgttaaaagcatcagaagttgtttctttagctgctacagctgcaagatttggt
ggttctaatgcaagcttacgtcatgaaagagtaaaatctgttgataaaacagaagatgtt
aaaaaacttccaattatcaatccattagttcagttacctatgtggccaaatgttagtgga
ggaactggacttattagtcaagcattacttgcaaatgcagatgcactttgtgctgcagta
tcaccattaatggatcctgatgaaacattaatggaaggttattttgaacgttgtgttatg
aataattattttggaatcggcatagatgcaaaaattagtcttgatttccatcataaaaga
gaagaacatcctgaaaaatgtcgatcacgagcaaagaattatatgtggtatggtgtatta
ggatccaaacaatggttgcaaaaaacatataaaaatcttgaacaaagagtacaattagaa
tgtgatggccaacgaataccattaccttccttacaaggaattgttgtattgaacattcca
agctttatgggtggtacaaatttttggggaggcacaaaagaaggagatttatttttagca
ccttcatttgatgatcgtatattagaagttgtagctgtatttggttctgttcaaatggct
gcatcacgattaattaatttacaacatcatagaattgcacaatgtcaaacagttcaaatt
aatattttgggtgatgaaggagtacctatacaagttgatggcgaagcttggattcaacct
cctggtattatacgtattatacacaaaaatcgtatgcaaatgctttatagaaatagggca
cttgaaacatctttaaaaacatgggaagaaaaacaacgcagcacactcaatgcaatatcc
caatcaatatcaactttaagcactacacaattgcaatcacaatctaaacttcttcaagta
cataataaaccaacacatttaaatgaagaagaaatgtatattctattgggatttattgaa
gtggttacaactttagttaaatgggttaaacttctcattatatcacatccaagtttggaa
ccagatttatatcaagttgcagcacgaacagcacaagcacttgaacaagttcatccagat
ggaaaaattttgcaaggaattaatttaagaccagtagtaacagaattggtgtcaagtgca
agacaactttatgaagactcgtgtgaattactcagagataaggcacataatttaaaatta
cgagaagacttagaaaataaactttcattttctttggccagtatggaacaagaattaaaa
aaatgtacatttgatgaaggaggtacaagattagtatatttacaaaacttaccatcagat
gaacagggagataaaaagaatcgtcatagaggtttgttttggttaaagtttcgacgttca
ggaattaattctggaacaaatctcgctcgagatcaagttactacatggggcgtacaagaa
gtatgttgctggttggaaaatctacagttgggtgaatataccgaaaaatttatttctcac
gatataagaggtagggagttattatcactagctcgtagagatctcaaagaacttggtatt
attaaagtaggacatgttaaacgaatcttacaagctatcaatgatctaaataattaa

DBGET integrated database retrieval system