KEGG   Apis mellifera (honey bee): 412526Help
Entry
412526            CDS       T01057                                 

Gene name
GB18501
Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    412526 (GB18501)
Enzymes [BR:ame01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     412526 (GB18501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 427 aa AA seqDB search
MQEFLGILLLISGAHCLYSNSDVINLKPNNFDNLVLNSDNVWVVEFFAPWCGHCQMLTPE
YNKAATALKGIVKVGAINADEHKSLGAKYGIQGFPTIKIFGIDNKPEDYNGPRTAAGIVD
AALNVAGQKARKILGGKRSTGDFKSKDSKDVIELTDDTFDNIVMNSDDMWLIEFYAPWCG
HCKNLAPIWASAATELKGKVKLGAIDATANRVKASQYEIKGYPTIKYFAPGKKSTDFVQE
YDGGRTSSDIVNWALEKLAENVPAPEVLQIINEKGLREVCENKPLCVISVLPHILDCQSE
CRNGYLKILNELGEKYKQKMWGWVWTEAGAQPHIEEALEIGGFGYPALAAVNIKKMKYSL
LKGSFSYDGINEFLRDLSYGRGGTAPLKGAQLPTILETKSWDGKDAELPQEEEIDLSDID
LDEKDEL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttttaggtattttgctgttaatttctggagctcattgtttgtactccaat
tcagatgtcataaatctaaaaccaaacaattttgacaatttggtattaaatagtgataat
gtatgggttgtggaattttttgcaccatggtgtggacattgtcaaatgttaacacctgaa
tataacaaagctgcaactgcactaaaaggtattgtgaaagttggtgcaataaatgcagat
gaacataaatctcttggagcaaaatatggaatacaaggttttcctacgattaagatcttt
ggtattgataataaaccagaagattataatggaccaagaactgcagcaggaatagttgat
gctgctttaaatgtagctggtcaaaaagcacgtaaaattttaggaggaaaaagaagtact
ggagattttaagtctaaagattccaaagatgtaattgaattaacagatgatacttttgat
aatatagtaatgaattcagacgatatgtggctaattgagttttatgcaccatggtgtggt
cattgtaaaaatttagctcctatttgggcatctgcagcaacagaacttaaaggtaaagtt
aaattaggagcaattgatgctactgcaaatagagtaaaagctagccaatatgaaataaaa
ggatatcctactattaaatattttgcacctggtaaaaaatctaccgattttgtgcaagaa
tatgatggtggtcgcacaagtagtgatatagtaaattgggcattagaaaaattggcagaa
aatgttccagcaccagaagtacttcaaattataaatgaaaagggtttaagagaagtatgt
gaaaataaaccgttatgtgttatatccgttttaccgcatattttagattgtcaatcagaa
tgcaggaatggatatttaaaaatattaaatgaacttggagaaaaatataaacagaaaatg
tggggttgggtttggactgaagctggtgctcaacctcatattgaggaagcattagaaatt
ggaggttttggttatccagcattagcagctgtaaatataaagaaaatgaaatattcttta
ttaaagggtagtttttcatatgatggtataaatgaattcttacgagatttaagttatgga
cgaggaggtacagctcctttaaaaggagctcaattaccaacaattcttgaaactaaatcg
tgggatggtaaagatgccgaacttccacaagaagaagaaattgatcttagtgacatagac
cttgatgaaaaggacgaactgtaa

DBGET integrated database retrieval system