KEGG   Apis mellifera (honey bee): 412644Help
Entry
412644            CDS       T01057                                 

Gene name
GB13002
Definition
josephin-like protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     412644 (GB13002)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C86
   412644 (GB13002)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 235 aa AA seqDB search
MVASTATDMTRSIYHERQVKELCALHALNNLFQERRFSKQELDQICYSLSPDVWINPHKS
LLGLGNYDINVIMAALQRRGHEAVWFDKRRDPKCLCLDNIEGFILNVPTEYKLGFVLLPL
KRRHWIALKKIHGAFYNLDSKLDSPQLIGKENDLLRYLKDQIDSKEKELFLVVSKEIDNN
QGWLINTYVNKEGINANHNTDIRYIEDGYTRIDLKKEESTEMNKNEKSLYDKNSR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgagtacagcaactgatatgactagatccatatatcatgaaagacaagtgaaa
gagctttgcgcattacatgcattaaataatttatttcaagaaagacgatttagtaaacaa
gaattagatcaaatttgttatagcttaagtccagatgtgtggattaatccccataaatca
ttattaggtcttggtaattatgatattaatgttattatggcagcattacaacgaagagga
catgaagcagtttggtttgataaacgcagagatcccaaatgtctatgtttagataatatt
gaaggttttatattaaatgtacctacagaatataaattgggatttgtattacttcctttg
aaaagacgacactggattgccctgaagaaaattcatggtgccttttataatcttgattca
aaacttgattctcctcaacttattggaaaggaaaatgatttgcttagatatctaaaggac
caaatagatagtaaagaaaaggaattatttcttgtcgtatcaaaagaaatagataataat
caaggatggttaataaatacatatgtaaataaagaaggaattaatgcaaatcacaatact
gatatcaggtatattgaagatggatatacaagaattgatttgaaaaaagaagagtccaca
gaaatgaataaaaatgaaaaatcattatatgataaaaattctaggtaa

DBGET integrated database retrieval system