KEGG   Apis mellifera (honey bee): 412644Help
Entry
412644            CDS       T01057                                 

Definition
(RefSeq) josephin-2
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     412644
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C86
   412644
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    412644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 239 aa AA seqDB search
MVASTATDMTRSIYHERQVKELCALHALNNLFQERRFSKQELDQICYSLSPDVWINPHKS
LLGLGNYDINVIMAALQRRGHEAVWFDKRRNFFRDPKCLCLDNIEGFILNVPTEYKLGFV
LLPLKRRHWIALKKIHGAFYNLDSKLDSPQLIGKENDLLRYLKDQIDSKEKELFLVVSKE
IDNNQGWLINTYVNKEGINANHNTDIRYIEDGYTRIDLKKEESTEMNKNEKSLYDKNSR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgagtacagcaactgatatgactagatccatatatcatgaaagacaagtgaaa
gagctttgcgcattacatgcattaaataatttatttcaagaaagacgatttagtaaacaa
gaattagatcaaatttgttatagcttaagtccagatgtgtggattaatccccataaatca
ttattaggtcttggtaattatgatattaatgttattatggcagcattacaacgaagagga
catgaagcagtttggtttgataaacgcaggaattttttcagagatcccaaatgtctatgt
ttagataatattgaaggttttatattaaatgtacctacagaatataaattgggatttgta
ttacttcctttgaaaagacgacactggattgccctgaagaaaattcatggtgccttttat
aatcttgattcaaaacttgattctcctcaacttattggaaaggaaaatgatttgcttaga
tatctaaaggaccaaatagatagtaaagaaaaggaattatttcttgtcgtatcaaaagaa
atagataataatcaaggatggttaataaatacatatgtaaataaagaaggaattaatgca
aatcacaatactgatatcaggtatattgaagatggatatacaagaattgatttgaaaaaa
gaagagtccacagaaatgaataaaaatgaaaaatcattatatgataaaaattctaggtaa

DBGET integrated database retrieval system