KEGG   Apis mellifera (honey bee): 412796Help
Entry
412796            CDS       T01057                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    412796
  Carbohydrate metabolism
   00640 Propanoate metabolism
    412796
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    412796
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    412796
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     412796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 440 aa AA seqDB search
MIKNSALKLNCVGGNSINTLKYLSTQTSGGGPIVEPALPQPLPQPQPQPQPQPQPQPDAL
PPLEIPVPHKSAIAGKEAQQTNIENDVLFKEVGNKGIIILNRPKALNALNLSMVEKIYPV
LKKWESSKKLVIIEGAGDKAFCAGGDIKSIGIEIKNTGNKALAEIFLKKEYTLNHLIGTY
KIPYIATINGITMGGGVGISVHGKYRIATEKTLFAMPETAVGLIPDVGGSYFLPRLKGKL
GLYLGLTGDRLQGIDVLLAGIATHFVPSEKLPNLKEDLLMTDKSDIKEILNKYQSKTLNQ
EFCLAPYMSKIDKYFSASCIEEIIERLKEDNSEWAKKTLQMLLKASPTALKFTMCSIQKG
STLNLADCLKMEFRLMCNFFNKNSDFCEGVRAVLIDKDRKPKWNPKNLIEVKDNYINQQF
NLLTNELHSIKLDYDVREIA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacagtgcattaaaattaaattgtgtgggtggtaattcaattaatactcta
aagtatttatcaacacaaacttcaggtggaggtcctatagtagaacctgcacttcctcaa
ccactacctcaaccacaacctcaacctcaacctcaacctcaacctcaaccagatgcttta
ccacctcttgaaattccagtacctcacaaaagtgcaattgcaggcaaggaagcacaacaa
acaaatatagaaaatgatgtcttatttaaagaagttggaaataaaggtattatcatattg
aatcgtccaaaagcattaaatgctttaaatttatcaatggttgaaaaaatatatccagta
cttaagaaatgggaatcatctaaaaaattagtgataattgaaggtgcaggagataaagca
ttttgtgcaggtggtgatataaaatcaattggtattgaaataaaaaatactggtaataaa
gccttagctgaaatatttttgaaaaaggaatataccttaaatcatctcattggtacatat
aaaataccatatatagcaacaataaatggaataactatgggaggtggtgttggaatatct
gttcatggtaaatatcgaattgctacagaaaaaacattatttgcaatgccagaaacagca
gttggattaattcctgatgttggtggaagttattttttacctagattaaaaggtaaatta
ggactttatcttggattgactggagatcgtttacaaggtattgatgtattacttgccggt
attgcaacacattttgttccttctgaaaaattaccaaatttaaaagaagatttactgatg
actgacaaatctgatattaaagaaatcttaaataaatatcaatctaaaacattgaatcaa
gaattttgtttagcgccatatatgagtaaaatagataaatatttttctgcatcatgtata
gaagaaattatagagagattaaaagaagataattcagaatgggccaagaagacattgcaa
atgttattaaaagcatctcctactgctctaaagtttacaatgtgtagtattcaaaaagga
agcacattgaatttggcagattgtttaaagatggagtttagattaatgtgtaattttttt
aacaaaaatagtgatttttgcgaaggtgtcagagccgttttaatcgataaagatagaaaa
ccaaagtggaatcctaaaaacttaatagaagtaaaagataattatataaatcaacaattt
aatcttttaacaaatgaattacatagtattaaattagattatgatgtcagggaaatagca
taa

DBGET integrated database retrieval system