KEGG   Apis mellifera (honey bee): 412796Help
Entry
412796            CDS       T01057                                 

Gene name
GB15565
Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    412796 (GB15565)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    412796 (GB15565)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    412796 (GB15565)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    412796 (GB15565)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     412796 (GB15565)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG15
AA seq 440 aa AA seqDB search
MIKNSALKLNCVGGNSINTLKYLSTQTSGGGPIVEPALPQPLPQPQPQPQPQPQPQPDAL
PPLEIPVPHKSAIAGKEAQQTNIENDVLFKEVGNKGIIILNRPKALNALNLSMVEKIYPV
LKKWESSKKLVIIEGAGDKAFCAGGDIKSIGIEIKNTGNKALAEIFLKKEYTLNHLIGTY
KIPYIATINGITMGGGVGISVHGKYRIATEKTLFAMPETAVGLIPDVGGSYFLPRLKGKL
GLYLGLTGDRLQGIDVLLAGIATHFVPSEKLPNLKEDLLMTDKSDIKEILNKYQSKTLNQ
EFCLAPYMSKIDKYFSASCIEEIIERLKEDNSEWAKKTLQMLLKASPTALKFTMCSIQKG
STLNLADCLKMEFRLMCNFFNKNSDFCEGVRAVLIDKDRKPKWNPKNLIEVKDNYINQQF
NLLTNELHSIKLDYDVREIA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacagtgcattaaaattaaattgtgtgggtggtaattcaattaatactcta
aagtatttatcaacacaaacttcaggtggaggtcctatagtagaacctgcacttcctcaa
ccactacctcaaccacaacctcaacctcaacctcaacctcaacctcaaccagatgcttta
ccacctcttgaaattccagtacctcacaaaagtgcaattgcaggcaaggaagcacaacaa
acaaatatagaaaatgatgtcttatttaaagaagttggaaataaaggtattatcatattg
aatcgtccaaaagcattaaatgctttaaatttatcaatggttgaaaaaatatatccagta
cttaagaaatgggaatcatctaaaaaattagtgataattgaaggtgcaggagataaagca
ttttgtgcaggtggtgatataaaatcaattggtattgaaataaaaaatactggtaataaa
gccttagctgaaatatttttgaaaaaggaatataccttaaatcatctcattggtacatat
aaaataccatatatagcaacaataaatggaataactatgggaggtggtgttggaatatct
gttcatggtaaatatcgaattgctacagaaaaaacattatttgcaatgccagaaacagca
gttggattaattcctgatgttggtggaagttattttttacctagattaaaaggtaaatta
ggactttatcttggattgactggagatcgtttacaaggtattgatgtattacttgccggt
attgcaacacattttgttccttctgaaaaattaccaaatttaaaagaagatttactgatg
actgacaaatctgatattaaagaaatcttaaataaatatcaatctaaaacattgaatcaa
gaattttgtttagcgccatatatgagtaaaatagataaatatttttctgcatcatgtata
gaagaaattatagagagattaaaagaagataattcagaatgggccaagaagacattgcaa
atgttattaaaagcatctcctactgctctaaagtttacaatgtgtagtattcaaaaagga
agcacattgaatttggcagattgtttaaagatggagtttagattaatgtgtaattttttt
aacaaaaatagtgatttttgcgaaggtgtcagagccgttttaatcgataaagatagaaaa
ccaaagtggaatcctaaaaacttaatagaagtaaaagataattatataaatcaacaattt
aatcttttaacaaatgaattacatagtattaaattagattatgatgtcagggaaatagca
taa

DBGET integrated database retrieval system