KEGG   Apis mellifera (honey bee): 412846Help
Entry
412846            CDS       T01057                                 

Gene name
Sirt6
Definition
(RefSeq) NAD-dependent protein deacetylase Sirt6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     412846 (Sirt6)
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     412846 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 407 aa AA seqDB search
MSCSYADGLSQYENKGVLGLEERYDSVEALRLKCGLLADWIQAARHVVVHTGAGISTAAG
IPDFRGTNGVWTLEQKGLKPTMNISFDEAIPTKTHMALKKLVDAKKVKFIISQNIDGLHL
RSGVQRQYLAELHGNMFTEQCDKCGRQFIRNFATKSVGKKSLDTVCRSEQIGGRPCRGRM
HDTILDWEHNLPDSDLTLSDLHSSVADLSICLGTTLQIIPSGNLPLYTKKYGGRLVICNL
QPTKHDKKADLIINGNVDEIMISVMKKLGLEIPEYESTMDPTRNSDTTSKEMDWTIPTSR
IKEMNVLYKKVCKPMRRKRKTFMYERERTDTKRETKTKKQAFMIKQDIKTEDTMNTANQI
CNNAVVSEDISSNTVKIEDEIKHVEPFEFTTNNMTQPDPGLEVNNIL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcagctacgcggacggtctctcgcagtacgaaaacaaaggagtgttgggtctg
gaagagagatacgacagtgtcgaggcattacgattgaaatgtggccttctagccgattgg
atacaggccgcacggcatgtcgtcgttcacaccggtgccggcatcagtactgcggcgggc
attccggattttcgaggtacaaatggagtatggacattagaacagaaaggtttgaaacct
acaatgaatatttcctttgatgaagccattcctacaaaaacacacatggcattgaaaaaa
ttagtagatgctaaaaaagttaagtttattataagtcagaacattgatggtttgcatctt
cgatctggtgtacaaagacagtatcttgcagaattacatggaaatatgttcactgaacaa
tgtgataaatgtggaagacaatttattcggaacttcgcgactaagagcgtaggaaaaaaa
tcccttgatactgtgtgtagatctgaacaaattggtggacgtccatgccgtggacgtatg
catgacacgattctcgattgggaacacaacttgcctgacagtgatctgacattatctgat
ttacattctagtgttgcggatttaagtatatgtcttggaacaacacttcagattatcccg
agcggtaatttacctctatataccaaaaagtatggaggtcgacttgttatatgtaatcta
caacctacaaaacatgataaaaaggcagatttaattattaatggcaatgttgatgagata
atgatcagcgttatgaaaaaattagggctagaaatccccgaatatgaaagtacaatggat
cccacacgtaattctgatacaacatccaaggaaatggattggacgataccaacaagtaga
ataaaagaaatgaatgttttgtataaaaaagtgtgtaaaccgatgagaaggaaacgaaag
acattcatgtatgaaagggagagaactgatacaaagcgagaaacaaaaacaaagaaacag
gcattcatgataaaacaagatataaaaacagaagatacaatgaacacagcgaatcaaatt
tgcaacaatgctgtagtttcggaagatataagcagtaatacggtgaaaattgaggatgag
ataaaacatgtggaaccatttgaatttacgacgaacaatatgacccaaccagatcctggt
ttagaagtgaacaacatactgtag

DBGET integrated database retrieval system