KEGG   Apis mellifera (honey bee): 412846Help
Entry
412846            CDS       T01057                                 

Gene name
Sirt6, GB17426
Definition
Sirt6 histone deacetylase
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     412846 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 326 aa AA seqDB search
MNISFDEAIPTKTHMALKKLVDAKKVKFIISQNIDGLHLRSGVQRQYLAELHGNMFTEQC
DKCGRQFIRNFATKSVGKKSLDTVCRSEQIGGRPCRGRMHDTILDWEHNLPDSDLTLSDL
HSSVADLSICLGTTLQIIPSGNLPLYTKKYGGRLVICNLQPTKHDKKADLIINGNVDEIM
ISVMKKLGLEIPEYESTMDPTRNSDTTSKEMDWTIPTSRIKEMNVLYKKVCKPMRRKRKT
FMYERERTDTKRETKTKKQAFMIKQDIKTEDTMNTANQICNNAVVSEDISSNTVKIEDEI
KHVEPFEFTTNNMTQPDPGLEVNNIL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttcctttgatgaagccattcctacaaaaacacacatggcattgaaaaaatta
gtagatgctaaaaaagttaagtttattataagtcagaacattgatggtttgcatcttcga
tctggtgtacaaagacagtatcttgcagaattacatggaaatatgttcactgaacaatgt
gataaatgtggaagacaatttattcggaacttcgcgactaagagcgtaggaaaaaaatcc
cttgatactgtgtgtagatctgaacaaattggtggacgtccatgccgtggacgtatgcat
gacacgattctcgattgggaacacaacttgcctgacagtgatctgacattatctgattta
cattctagtgttgcggatttaagtatatgtcttggaacaacacttcagattatcccgagc
ggtaatttacctctatataccaaaaagtatggaggtcgacttgttatatgtaatctacaa
cctacaaaacatgataaaaaggcagatttaattattaatggcaatgttgatgagataatg
atcagcgttatgaaaaaattagggctagaaatccccgaatatgaaagtacaatggatccc
acacgtaattctgatacaacatccaaggaaatggattggacgataccaacaagtagaata
aaagaaatgaatgttttgtataaaaaagtgtgtaaaccgatgagaaggaaacgaaagaca
ttcatgtatgaaagggagagaactgatacaaagcgagaaacaaaaacaaagaaacaggca
ttcatgataaaacaagatataaaaacagaagatacaatgaacacagcgaatcaaatttgc
aacaatgctgtagtttcggaagatataagcagtaatacggtgaaaattgaggatgagata
aaacatgtggaaccatttgaatttacgacgaacaatatgacccaaccagatcctggttta
gaagtgaacaacatactgtag

DBGET integrated database retrieval system