KEGG   Apis mellifera (honey bee): 412917Help
Entry
412917            CDS       T01057                                 

Gene name
GB14600
Definition
(RefSeq) probable serine/threonine-protein kinase dyrk2
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     412917 (GB14600)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   412917 (GB14600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG6
AA seq 1205 aa AA seqDB search
MLGVSQPGNPPSSLRHSASFSCLQRGTASEGHRARTSTLLQTQPSLQLSNSHHQAYAPGQ
ATSSLLQQSSSAVGTVQHRIEALEASTVQDTGNDYGFVKLRPRLRSTNATLHYEEELAAQ
RGAIWDRDASAFSDRECDGNYRGDPPSLKLKDNREHSPKGGKNQNPLRGALILFTSTSSW
WKARQREDQLNGGVAAAFASSSERKWSSTSMASPSNERKWPSLVTSPTNDRKWSLAANNN
NNNNNNSNNALTSPGNERKWTRSSVTSNSGGQQDRKWRSLGALLRAPTGAATPASHAVQH
SLSHNMSVSMIEDHHFREDARGSASCKSTRYQQPAATSYSARVSRVTRDVYRENGSEFGQ
AGGRSKVSRRLYQEDCLDRDAAEERSHQAPRQQHQFDEECRGGRANRESAICKTEQQTVN
ETAGGTRASTTRSSRAQSFYLLDDFLRPQPQQNNATNNNNNNNNNKCMLNVYLSPSHAAS
KSTCGGNDLLHSGRSGDQAKHQVPPQAGSANVTNITPPRRHNSSSDSLEVATSPLPPPVP
PPPPQVAATRDRERAENLKEKDVCQCKVCWTNMQQQRCFVEEVSRRSKERASLYQETGRS
PGTLHKDVGGAGTKVSGKTVGGVGTATLTTLSSINNTSNTSRNKNNPVSQEKLLSFFHPK
TTRVDKSDNNNTTNSTTNNIHNNLPIHEPINATSHDVYPGRLPMTAPEALKYYGSRLTEF
ERNEIEKYSEIWYLGLSATKIHGEEGSSQNGGYDDENGSYNKVFHDHISYRYEILEVIGK
GSFGQVIRALDHKTGQYIAIKIIRNKKRFHHQALVEVEILEHLRKKDLEANASHNVIHML
EYFYFRNHLCITFELMSLNLYELIKKNNYKGFSLSLIRRFANSLISCLRLLYREKIIHCD
LKPENVLLKQRGSSSIKVIDFGSSCYSHQRVYTYLQSRFYRSPEVILGLPYGTPIDMWSL
GCILAELYTGCPLFPGEDEIEQLACIMEVLGLPPEHIINHASRRRLFFGDPRCVTNSKGK
KRWAGSRNLAIALRCTDTLFVDFVRRCLEWDPKKRMTPDEAMRHEWLNSSSFHVSSSTST
IAASTVNANTNANATSMETSSQSAHAQTVSVTVSAPRQRATTVEDPPYTMYRLCKGRKYV
QRISTTENTDNGGLVVKSKLNGSASSHALASSTQTTTSRHASTGDIVASLDPNLDDSGTF
LPPIL
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgttgggagtgagtcaaccgggaaacccaccctcgagcctgcgacactcggcgagtttc
tcgtgtcttcaacggggcacggcgagcgagggacacagggcgaggacctcgactctgctc
caaacacagccgagcctccagctgagcaacagccatcaccaggcgtacgcgcccggccag
gcgacctcgtccctcctccaacagtcctcctcggccgtggggaccgttcaacaccgcatc
gaggcgttggaagccagcaccgtgcaagacaccggcaacgactacggtttcgtcaagcta
cgcccacgcctgcgtagcaccaacgccaccctccactacgaggaggagctggccgctcag
aggggcgctatatgggaccgggacgcgtcggcgttcagcgaccgcgagtgcgacggcaac
tacaggggggacccgccctccctcaagctcaaggacaacagggagcactcgcccaagggc
gggaagaatcagaacccgctcaggggcgccctcatactgttcacctcgacctcgtcgtgg
tggaaggcaaggcaacgggaggatcagctgaacggcggcgtggcggcggcgttcgcctcc
tcgtccgagcgaaagtggtccagcacctcgatggcgtccccctcgaacgagagaaagtgg
ccctcgctcgtcacctcgcccaccaacgatcgcaaatggtcccttgcggccaacaacaac
aacaacaacaacaacaacagcaacaacgctttgacgtcgccgggtaacgagaggaagtgg
acgagatcgtcggtcacgtcgaactcgggcgggcagcaggacaggaaatggcggtcgctc
ggcgccctgttgagggccccgaccggcgcagcgacgcccgcctcgcacgccgtccaacac
tccttgtcccacaacatgagcgtctcgatgatcgaggaccaccacttcagggaggacgcc
cggggctcggcatcgtgcaagtcgacgcgttaccaacaaccggcggccacctcgtactcg
gcccgggtgtcgcgcgtcacccgggacgtttacagggagaacgggtcggagttcgggcag
gcggggggcaggtcgaaggtgagccgtaggctgtatcaggaggattgcttggacagggac
gcggcggaggagagatctcaccaggcgccgaggcagcaacaccagttcgacgaggagtgc
aggggagggcgcgcgaatcgggagagtgcaatctgcaaaacggagcagcagacggtgaac
gagactgcgggtggcacgcgcgcttccacgacgagatcgagccgggcgcaaagcttctat
ctcctcgacgatttcctgcggccccagccccaacagaacaacgccactaataacaataac
aataacaataacaacaagtgtatgctgaacgtttacctgtcgccgtcgcacgccgcgtcc
aagtccacgtgcggcggcaacgatctgctgcactcgggcagatcgggcgaccaggcgaag
caccaggtccccccgcaggcagggagcgccaacgtgacgaacatcactccgccgcggcgc
cacaactccagctcggacagcctcgaggtcgcgaccagtccgcttccgccgcctgtcccg
cccccgccacctcaggtcgccgcgacccgcgacagggagagggcggagaatttgaaagag
aaggacgtgtgccagtgcaaagtgtgctggaccaatatgcagcagcaaagatgtttcgta
gaagaggtgagtaggcgctccaaagaacgtgcatctctctaccaagagacggggaggagt
cctggaacgctgcacaaagatgtcggtggtgctggtaccaaggtcagcggaaagacggtc
ggcggtgtcggcactgcaacccttaccacgctctcttccattaataatacatccaatacc
agccggaacaagaacaatcccgtatcccaagagaaattactgtcattctttcatcccaaa
acgacgcgagtggacaagtctgacaacaacaacacgaccaactccaccaccaacaatatt
cacaacaacctgccgatacacgagcctatcaacgccacatctcacgatgtgtatcctggg
agattgccaatgacagctccagaagcactcaagtattatggctcgaggctcaccgaattt
gagcgcaacgaaatcgagaaatactcggagatttggtacctcggcctgtcggccacgaaa
attcacggcgaggagggctcatcccaaaatggtggatacgacgacgaaaacggtagttac
aacaaggtcttccacgatcatatctcgtacagatacgagatattggaggtgatcgggaag
ggaagcttcggacaagtgatcagagcgttggatcacaagacgggacagtacattgccatc
aagatcatcagaaataaaaagagattccatcatcaggcgttggtcgaggtggagattttg
gaacatctcaggaagaaagatttagaagcgaatgcgtcgcacaatgtgatacacatgcta
gaatacttctacttcaggaaccatttgtgcatcacctttgagttaatgagtttgaattta
tacgagctaatcaaaaagaataactataagggatttagtctgagcctaatacgacgattc
gccaattctttaattagctgcctgagactgctgtaccgagagaagataattcattgcgat
ttgaaacctgaaaacgtgcttctgaaacagcggggtagcagctcgattaaggtgatagac
ttcggatcctcgtgttacagccatcagcgtgtatatacataccttcagtccagattttat
cgtagcccggaagtgattctgggccttccatacggtacaccgatcgacatgtggagtttg
ggctgtatcctggccgaactctacacaggttgccctttgttcccgggcgaggatgaaatc
gaacaacttgcctgcattatggaagttcttggcctgccaccggaacatattattaatcac
gcatcccgtcgcaggcttttcttcggtgatcctcgatgcgtgacgaacagtaagggcaag
aagagatgggctggtagcaggaatcttgccatagctcttcgttgcaccgatacacttttc
gtcgactttgttcgcagatgcctcgagtgggatccaaagaaacgcatgacccccgacgag
gcgatgcgtcacgagtggctgaactcgtcctcgtttcacgtgagctcctcgacgtccacg
atagccgcgtcgacggtgaacgcgaacacgaacgcgaacgcaactagcatggaaacgtcg
tcgcaatccgcccacgctcaaacggtgagcgtgacggtgagcgcgccgaggcaacgggcg
accaccgtcgaggatcccccgtacacgatgtaccgtttgtgcaaaggtcgtaagtacgtg
cagaggatcagcacgaccgagaacacggacaacgggggcctcgtagtgaagagcaagctg
aacggaagcgcgagcagccacgcgctcgcgagtagcacgcagactactacctcgaggcac
gcctcgaccggcgatatcgtcgcgagtctggacccaaatctcgacgattccggtacgttt
ttaccgccgatattgtga

DBGET integrated database retrieval system