KEGG   Apis mellifera (honey bee): 412948Help
Entry
412948            CDS       T01057                                 

Gene name
GB15049
Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ame  Apis mellifera (honey bee)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    412948 (GB15049)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    412948 (GB15049)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     412948 (GB15049)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     412948 (GB15049)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 774 aa AA seqDB search
MYARLLLLRSSKLGCFPRRLASSSSGPRVPEQATTEGPRKATMFNDRSQLNYTRRLVVKL
GSAVITREDEHGLALGRLASIVEQVAECQNGGRECIMVTSGAVAFGKQKLAQELLMSLSM
RETLSPGGHMRKRSGTPLEPRAAAAVGQSGLMSLYDAMFAQYGVKLAQVLVTKPDFYNEE
TRNNLFSTLSELLSLNIVPIINTNDAVSPPPHVDEEVAGSGGRRGISIKDNDSLAAMLAA
EIQADLLILMSDVDGIYNLPPWQDGAKMLHTFSMDLRDTIKFGQKSKVGTGGMDAKVNAA
LWALDRGVSVVICNGTQEKAIKNILSGRKIGTFFTQTTEISMPVEVVAEEARTGSRTLQA
LRPEERASCINTLADLLESRQKEILEANRKDLEAAEKTGLAKALLSRLSLTPAKLKSLSS
GLRQIANDSLTNVGRVLRRTKLAEGLELRQITVPIGVLLVIFESRPDSLPQVAALAMSSA
NGLLLKGGKEATNSNKYLMELVKEALGPVGAANAISLISTREDVGDLLSMGKHIDLVIPR
GSSDLVRSIQEQSKHIPVLGHAEGICHVFVDRDADLVKALKIIRDSKCDYPAACNAMETL
LIHESHMKSNFFNDVCSMLQKEGVKVNSGPKLRKQLTFGPPAAKSMKTEYGALECAIEVV
SDIEDAINHIHKYGSGHTDCIVTENKERATYFQREVDSACVFHNASTRFSDGYRFGLGAE
VGISTARIHARGPVGVDGLLTTKWVLQGNGHAAADFGEGGEVWLHQSLPLNESE
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgaggttgttactattgagatccagtaaacttggatgttttccaaggagattg
gcttcgtcctcctcggggccgagggtgcccgaacaagcaacgacagaagggcctcgaaag
gcaacgatgttcaacgaccgcagccagttgaattacaccagacgtttggtggtgaaattg
ggcagcgccgttatcacgagggaggacgaacacggactggcactgggtcggttggcgtcc
atagtcgaacaggtagccgagtgccaaaacggaggtcgtgaatgtattatggtaactagc
ggagcggtcgcattcggcaaacagaaactcgcccaggaactgttgatgtccttatcaatg
agggaaacgctgagtcctggcggccacatgagaaaacgctcgggcactcctttggaacct
agagcggcagccgcggtgggtcaatcgggtctaatgtctctatacgacgccatgttcgcc
caatatggcgtgaaactggcccaagtgttggtcaccaaaccggatttctacaacgaggag
acccgcaacaacttgttcagcactttgagcgagttgctcagcttgaacatagtccccata
atcaataccaacgacgcggtgtcacctccgccacacgttgacgaggaagtcgctggaagc
ggcggaagaagagggatttccatcaaggacaacgattccttggccgccatgttggccgcc
gagattcaagcggacttgttaatcttgatgagcgatgtagatggcatttacaatctgcct
ccttggcaagatggcgccaaaatgctgcatacgtttagcatggatcttagagacacgatt
aaatttgggcaaaaatcgaaggtcggtacaggtggcatggatgcgaaagttaatgccgcg
ctttgggcccttgatcgaggtgtctccgtagtaatttgcaatggaactcaagaaaaggct
ataaagaatattttatctgggagaaagataggtactttcttcacacagacgaccgaaatt
tccatgcctgtagaggttgtcgccgaagaggctcgaactggaagccgaacactgcaagct
cttcgaccagaagaacgagcgagctgtatcaacacgttagctgatcttctggagtcacgg
caaaaggaaatattggaggctaacagaaaggatctcgaggctgcggagaaaactggtctg
gcgaaagctttactttctcgcctttcgttaacacccgccaaactgaaatctttgagctct
ggtttgcgacaaattgctaatgattccttaacgaatgtgggacgcgtgctcagaaggaca
aaactggccgagggtctggaattgagacaaataactgtccccatcggtgtactgttggtg
atttttgaatcacggcccgacagtttacctcaagtagccgcattagcgatgtccagtgcc
aacggcctccttctgaaaggaggcaaagaagcgacaaacagcaataaatatttgatggag
ttggtgaaggaggcgttgggtccggttggtgctgcaaacgcgatatctttaatttcgacc
agggaggacgtcggcgatttattgtcgatgggaaaacacatagatctcgtaattcctcga
ggcagctcagatctcgttcgtagcattcaggaacaatcgaaacatattcccgtattggga
cacgcggaaggtatctgtcacgtgttcgtggatagagatgcggatcttgttaaagctcta
aagatcatcagagactcgaaatgcgattaccctgctgcttgcaacgctatggagacattg
cttattcacgagagtcatatgaagagtaactttttcaacgatgtgtgcagcatgctgcaa
aaggaaggagtcaaagttaattccggaccaaaactgaggaaacaattaacattcggacca
ccagctgcgaaaagtatgaagaccgagtacggcgctcttgagtgtgcaatcgaggtcgta
tcagacatcgaggatgcaataaatcatattcacaaatatggcagtggacatacggattgc
attgttaccgagaataaagaaagagccacctatttccagagagaagtggacagtgcgtgc
gtttttcacaatgccagtactcgattctccgatggttatagattcggtcttggtgccgag
gttggaatttctaccgcacgaattcatgcacggggtccagtaggagtggatggattgttg
actacaaaatgggtattgcaaggtaatggtcatgcagctgcagattttggagagggtggc
gaagtttggcttcatcaatctttacctctcaatgaatctgaatga

DBGET integrated database retrieval system