KEGG   Apis mellifera (honey bee): 413101Help
Entry
413101            CDS       T01057                                 

Gene name
Tip60, GB11045
Definition
histone acetyltransferase Tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 453 aa AA seqDB search
MIEEHDEHETICDSVNSLVEGCRLPVRMHGTDDWPLAEIISVKEVHGVKCYYVHYVDFNK
RLDEWVTEDCLDTRKVQYPRRDGTTPGTGAATPKKQVPSRPPSPSSLCNEPVNGSAVLQA
ALQKKMSRKRKATFIENDDSQDGPPQTPGPRPTGSLVAHHHDDIVTRMKNVELIELGRHR
IRPWYFSPYPQEMVHLPCIYICEFCLKYRKSRKCLERHLAKCNLRHPPGNEIYRKGSISF
FEIDGRKNKNYAQNLCLLAKLFLDHKTLYYDTDPFLFYIMTNFDSRGYHIVGYFSKEKES
SEDHNVACILTLPPYQRRGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAHT
ILDILLNVKPLVENEKPQITISEICELTSIKKEDVISTLQNLNLINYYKGQYIVTLNREI
IEQHTAAMEKRQIRIDPKCLHWTPKDWSVRAKW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggaacacgacgagcacgaaacaatatgcgactcagtgaattcgctggtggaa
ggctgccgtttaccagttagaatgcatggaacggatgattggcctcttgctgaaatcatc
agtgttaaagaagtacatggtgtcaagtgttattatgttcactatgtagatttcaataaa
cgattagatgaatgggttacggaagattgtttggacactcgaaaagtccaataccctcgt
cgagatggaaccacaccaggaactggtgcagcaacgccaaaaaaacaagtacccagtaga
ccacctagccctagtagcctttgtaatgaaccagtcaatggttctgcagttttgcaagct
gcattacaaaagaaaatgtctagaaagagaaaggccacatttatagaaaacgatgattct
caggatggtccaccgcaaacacctggtccaaggccaactggttcattagtggcgcatcat
catgatgatatagttactagaatgaaaaatgttgaattgatagaattgggtcggcataga
ataagaccttggtatttcagtccatatccgcaagaaatggtacatttaccatgtatatac
atttgtgaattctgtttgaaatatagaaaaagtcgaaaatgtttagagcgacatttagca
aagtgtaatttaagacatccacctggcaatgaaatatatagaaaagggtcaatatctttt
tttgaaattgacggtagaaaaaacaaaaattacgcacaaaatctatgtctactagcaaaa
ttatttttggatcataaaacgctatattatgacacagatccatttttattttatataatg
acaaattttgatagtagagggtaccatatagttggttacttctcgaaggagaaagaatcg
tctgaagatcacaatgtagcttgtattcttacactgccaccgtatcaaagaaggggttat
ggaaaattattaatagaattttcatatgaattatccaaattcgaaggtaaaacaggttca
cctgagaaaccattgtcggatttgggattattatcttatagaagttattgggctcatact
atattggacattctattgaatgtaaagccattagtagaaaatgaaaaaccacagatcacg
ataagtgagatatgcgagctgacatcgattaagaaagaagacgtgatatcgacgcttcaa
aatttgaatcttattaattactacaaaggacaatatattgtgacattgaatagggagatt
atcgagcaacacacagccgcaatggaaaagaggcaaatcagaatagatcctaagtgtctt
cattggacaccaaaagactggagtgttagggcaaaatggtga

DBGET integrated database retrieval system