KEGG   Apis mellifera (honey bee): 413189Help
Entry
413189            CDS       T01057                                 

Gene name
GB11355
Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    413189 (GB11355)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     413189 (GB11355)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG6
AA seq 308 aa AA seqDB search
MSNLRSLVVSVLAAVGTIAVIGLAVKFYKCWNSDKKKKSPILLVDPVVKYSLPLIKKDIL
SHDTRKFRFALPTSDHILGLPIGQHVHLTVKIGDEVVIRSYTPVSSDDDHGYVDLVIKVY
FKNVHPKFPEGGKMSQYLENLKIGETVDFRGPSGRLIYKGHGNFSVKILRKDPPTEYNVK
KIVMLAGGTGITPMLQLIRAIIKDSTDETQTSLLFANQTEKDILLRDELDDIAKNHPNKL
KLWYTLDTSSENWQYSTGHINADMIKDHMFPPSSDTMVLMCGPPPMINFACNPNLDKLGY
DPKLRFAY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacttacgatcactagttgtatcagtattggctgctgtaggaactatagctgta
attggattagcagtcaaattttacaaatgttggaatagtgataaaaaaaagaaatctcct
attttattggttgatccagtagttaaatatagtttaccattaataaaaaaagatatatta
agtcatgatacaagaaaatttagatttgcattgccaacatcagatcacatattgggatta
ccaattggtcaacatgtacatttaactgtaaaaattggagatgaagttgttatacgctct
tatacaccggtatcaagtgatgatgatcatggttatgtagatcttgttattaaagtatat
tttaaaaatgtacatccaaaattccctgaaggaggaaaaatgtctcaatatttagaaaat
ttgaaaattggggaaacagttgattttagaggaccttctggtcgacttatttataaaggt
catggaaatttttctgtaaaaattttaagaaaagatccacctacagaatataatgttaaa
aagattgtgatgctagctggtggaacaggaatcacaccaatgcttcaattaattcgtgct
ataataaaggattctactgatgaaactcaaacttccttactttttgccaatcaaacagaa
aaagacatattacttcgagatgaattggatgatattgcaaagaatcatcctaacaaattg
aaactttggtatacattagatactagtagtgaaaattggcaatatagtacaggtcatata
aatgcagatatgataaaagatcacatgttccctccatcatctgatacaatggtacttatg
tgtggtccacctccaatgatcaattttgcttgtaatcctaatcttgataaacttggttat
gatccaaaattaagatttgcatattag

DBGET integrated database retrieval system