KEGG   Apis mellifera (honey bee): 413357Help
Entry
413357            CDS       T01057                                 

Gene name
GB15579
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 31-like
  KO
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     413357 (GB15579)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   413357 (GB15579)
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    413357 (GB15579)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 915 aa AA seqDB search
MVFPWPAMNGENVSAVMKSVSEGELGVEEVKLSESKIQDSIPRLKRTFTLPRNPFQSASR
MLRRRPKQNRDSKDSSSATSTKDRNNMQQHQQQVESIQQNMSRLHGSQSYPERPGVKKVF
RRPSWKKFINKMVQHMSNVGTQNHKTSHRDDLSSSAGDIRVPPPRPAHIPPDRVPGVIGL
RNHEYFVLDQYKVDLSRRNKLNSKKYGTKGEITEQLALLLKAIWSCQYDPEMSTAFKSVV
DKYGSQYRGNLQHDAQEFLLWLLDKVHEDLNQATKKKYKIIKNSFGRPDDIVAAETLANH
VRCNNSFVHAVFQAQFRSSLTCPRCHRQSNTFDPFLCVSVPVPQNHRQMNLFVNVLYTSQ
QPRQVKIGVSVNQMANVRELREILASDTGIDENHMLLTEVHDEGFHRTFSDCQPLSVITE
NDPLYCIELPQLKEPTEQAYILLVWINILMKGDLRQRFGSPYTMQVSRETSYEDLQKLLL
KEMHSVLADDVLTSSQSPGLFNIRVADPAATPIQDEHPCIDPCVEHPLYTEQIEQALALC
ADDSGPQHVKLILEWDEATKCNIIQDDSDQIEEHASVKQLKTNSELGGAVTLEECFDLYT
RAEILGAEDAWHCPYCNKKQEVVKKLGLWSLPDILVIHLKRFRQQSKQRSTSKLTMLVDF
PLYGFDMTPHLAHNGVQTHNNVGSLGGLGWSPWKKPRPRQQNIPKYDENVYDLYAICNHH
GQDLQGGHYTAFCRNPYDTQWYCFDDTRVEAVNDTNLITNAAYMLFYQRRGLTNNSGNSS
AASTSSAGSGLDHWVSKMPPFYFNNKTNNNVSNNNQSKSQEVLCQDKIVEEKNITNFNRG
CRNYATLQPKKRNVATETDISQIDHYSDDEAPCRREWASPKPVRKMSSITLIPQSTIIHS
ASSDPDTTIIHESTL
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttccgtggccggcgatgaacggtgaaaatgttagtgcggtgatgaaatcggtg
tcggagggtgagctgggcgtggaagaggttaaattatcagaatcgaaaatacaggattct
atcccgcgtttaaaacgtacgtttactttgccgagaaatccgtttcaaagtgccagcagg
atgttaagacgacgtccgaaacaaaatcgtgattcaaaagacagtagcagtgcaacgagt
actaaagacagaaacaatatgcagcaacatcagcagcaagtggaaagcatacaacaaaat
atgagtcgattacatggcagccaaagttatccggaaaggcctggtgtaaaaaaagtgttc
cgtagaccttcctggaaaaagtttatcaacaaaatggtccaacacatgtcgaacgtgggc
acacagaatcataaaacttctcatagggacgatcttagttctagtgctggagacataagg
gtacctccgcctcgaccggcacatataccgcctgatagagtgccaggggtcataggttta
cgcaatcacgaatatttcgtgctggaccaatacaaggtcgatttatccagaaggaataag
ctaaactctaaaaaatatggaacaaaaggagagatcacagaacagttggctcttttatta
aaggctatctggagttgtcaatacgatccagaaatgagcacagcgttcaaaagcgtcgtc
gacaaatacggaagtcagtatcgcgggaacttgcagcacgatgctcaggaattcttgtta
tggctattagacaaagtgcacgaagacttaaatcaagctaccaaaaaaaaatataaaatc
ataaagaattctttcggcaggccggatgatattgtcgcggcggaaactttggcgaatcat
gtccgttgtaataattcgtttgtgcatgcggtgttccaagctcaatttcggtctagtttg
acttgtccaagatgtcaccgacaatcgaatacgttcgatcctttcctctgtgtgtcagta
cctgtcccgcaaaatcatcgacagatgaatcttttcgtgaacgttctttatacgtcgcaa
caaccgcggcaagtaaaaatcggtgtaagtgtaaatcagatggccaacgtaagagaactt
agagaaattttggccagtgataccggtatagatgagaatcatatgttactcacggaagtt
catgatgaaggatttcatagaactttctctgattgccaacctttatctgtgatcacggaa
aacgatccgctttactgtatagaactgccacagttgaaggaacctacagagcaagcgtat
attctactcgtatggattaacattcttatgaaaggagatctgaggcaacgttttggtagt
ccgtatactatgcaagtatctagagaaacatcgtacgaagatctgcaaaaacttttattg
aaagagatgcatagtgttctggctgatgatgtgcttacgtcgagtcagagtcctggactg
tttaacattcgagtggcggaccctgcggccactcctattcaagatgaacatccgtgtata
gatccttgtgtagaacatcccctttacacagaacaaattgaacaagcattggctctctgc
gccgatgattctggccctcagcatgtaaaattaattcttgaatgggacgaagccactaag
tgcaatattattcaggatgacagtgatcaaatcgaagaacatgccagtgtgaaacaattg
aaaacaaattctgaactggggggagctgttactttggaagaatgttttgatctatacaca
agagccgaaatattaggagcggaagacgcgtggcactgtccatattgcaataagaaacaa
gaagttgtgaagaaattgggtctttggtctttacctgatatcttagttattcatttaaaa
agatttcggcaacagtctaaacaaagatccacatccaaattgaccatgttagtcgatttt
cctttgtatggtttcgatatgactccccatcttgctcataatggggttcaaacgcataat
aacgtgggtagtttaggtggtctaggctggtcaccctggaaaaaacctagacctcgtcaa
caaaatattccaaaatatgacgaaaacgtttacgatctttatgcaatttgtaaccatcat
ggacaagatttacagggaggtcattacacagcattttgccgaaacccatatgatactcaa
tggtattgctttgacgatacccgagtagaagccgtaaatgatactaatttaataacaaat
gctgcatacatgttgttttatcaacgtagagggttaactaataattctggtaattcttca
gccgcatctacaagttctgccgggtctggacttgatcattgggtttcaaaaatgccacca
ttttattttaacaataagactaataacaatgtttcaaataacaatcaaagcaaatcacag
gaagtgttgtgtcaagataaaatcgtagaagaaaagaatataacgaattttaatagagga
tgtcgtaattatgctactttgcaaccgaagaaaagaaatgttgcgacagaaacggatatt
agccagattgatcactattcagacgatgaagcaccttgcagaagagaatgggcttcgcca
aaacctgttcgaaaaatgtcgtccattacgttaataccgcaatctacgataattcatagt
gccagtagtgatccagatacaacaataatacacgagtcgacgttgtaa

DBGET integrated database retrieval system