KEGG   Apis mellifera (honey bee): 413389Help
Entry
413389            CDS       T01057                                 

Gene name
hem, GB17167
Definition
HEM-protein
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ame04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 764 aa AA seqDB search
MSSTLENKILNLQERLRAENESRDRDRQNSEVGPGTSLQSSSSGSVSSSASRPPIPTLKV
SQIPPKKQDSEFESKLQEIMKMNGILNINGQRYQTEMKDLEHLGELGNGTCGHVVKMRHK
PSGVLIAVKQMRRSGNAEENKRIIMDLDVVLKSHDCPYIVQCLGCFITESDVWICMELMA
TCLDKLLKKTRQAMPEEFLGKVTVATVKALSYLKEKHGVIHRDVKPSNILLDERGGVKLC
DFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGITLVELATGVF
PYRDCKTDFEVLSRVVQDDPPSLPPDASFSKEFRNFVSCCLTKNYKHRPKYHKLMEHPFI
RKYDVPQDEETNSSVLNSSCQWFGRVMQQLEPSFRLPGWQQRITGHVSLKQTAHLRAQSE
VPAFLRSNVTKDSQNSSFLPFHQRSNSENGANYVSYSPYALRRKEISRPFSPPSSNEADI
SETNFQRPYSPYKQHVDQNRDYSSNHCSINGQGRQEGRPFSPYRQDISTIEGNRLYSPYH
GRFTEDRDTSKERWQGVSRSLSPFARDYSPWRRENVDPPNVIQSTESGRYSPFLQQRLGQ
TPSVPQTHPQTQDIYGSPMISRKRFPSEPPPQGSHGSTSPELLISRFAHQLKQEPSSVMP
PVQGGSKESAKKRFASYVRLRLGSERAPSPEPPPRLSRGESPLALRRNLIDQASPSFARR
YVSSSPPQPPPRRLSESNSVPGSPQHVRARLRYTPEPQRRPPPP
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtactctggagaataagatcttaaatttgcaagaacgtcttagagcagaaaat
gaatcaagagatagagatagacagaacagcgaggttggaccaggaacgagccttcaatcg
tcatcttcgggatctgtctcgagttctgcttcacgtcctccaataccaacattgaaagtc
tcacagatacctccaaagaaacaggatagtgaatttgaatcaaaactacaagaaattatg
aaaatgaatggtattttaaatattaatggtcaaaggtatcaaactgaaatgaaagattta
gagcatctaggtgaattgggaaatggtacctgtggtcatgttgtaaaaatgaggcataaa
cctagtggtgtactcattgctgtcaagcaaatgagacgttctggtaatgcagaagaaaat
aaaagaataattatggatcttgatgttgttttaaaatcacatgattgtccatatattgtg
caatgtttgggttgttttattactgaatctgatgtatggatttgtatggaattaatggca
acttgtttagataaattattaaaaaaaactagacaagcaatgccagaagaatttttagga
aaagttacagtagcaacagtaaaagcattatcatatttgaaagaaaagcatggtgtaatt
cacagagatgtaaaacctagtaacatacttcttgatgaaaggggaggagttaaattatgt
gattttggtatatctggtagattagttgatagtaaagcaaaaactagaagtgcaggatgt
gctgcttatatggctcctgaaagaatcgatcctcctgatccaactaaaccagattatgat
ataagagcagatgtttggagtttgggtatcactttagttgaattagctacaggggtattt
ccttacagagattgtaagactgattttgaggtattgagcagagtagtacaagatgatcct
ccctcccttccaccagatgcatcgttttctaaggaatttagaaattttgtgagttgttgc
cttacaaaaaattataaacatcgtccaaaatatcataaactcatggaacatccttttatt
cgaaaatatgatgtaccacaagatgaagaaacaaactcttcagttctaaattctagttgc
caatggtttggcagagttatgcaacaattggaaccaagtttcagattgccagggtggcag
cagcgaatcacgggtcatgtatctctaaaacaaacagctcatctcagggctcaatctgaa
gtaccagctttcctacgaagcaatgtcaccaaagactcacaaaactccagctttttgcca
tttcatcaacgatcaaatagtgagaatggtgcgaactacgtatcttatagtccatacgct
cttagacgaaaggaaatttccaggccattttctcctccttcgtccaatgaggcggatata
tcagaaacgaattttcaacgaccatattcaccatataaacaacatgtcgatcaaaatagg
gattattcttcaaatcattgttctattaatggacaaggtagacaagaaggaagaccgttc
tctccatatcgacaagatattagtacaatagaaggaaatagactttattcaccatatcat
ggacgtttcacggaagatcgagataccagtaaggaaagatggcaaggtgtctctagatct
ttaagtccatttgctcgagattattcaccatggaggagagaaaatgttgaccctccaaat
gtaatacaatcaactgaaagtggacgttattctccatttcttcaacaacgattaggacaa
actccatctgtgcctcaaactcatccacaaacgcaagatatttatggtagtcctatgatt
agtcgtaaaaggtttccttctgagcctcctccacaaggatctcatggttctactagccct
gaattattaatttctcgttttgctcatcaattgaaacaagaaccttcatctgttatgcca
cctgttcagggtggatctaaagaatctgccaagaagcgttttgcttcttatgttcgtctt
agacttggaagtgaacgtgctccttcgccagaaccaccaccaagattaagtcgtggtgaa
tctcctctcgctcttagaaggaatttaatagatcaagcctctccttcttttgcacgaagg
tatgtttcatcttctccgcctcaaccacctccaagaaggttatcggaaagtaattccgta
cctggtagccctcaacatgtacgagctcgattacgttacactcctgaaccgcagaggaga
cctccgcctccataa

DBGET integrated database retrieval system