KEGG   Apis mellifera (honey bee): 413389Help
Entry
413389            CDS       T01057                                 

Gene name
hem, GB17167
Definition
HEM-protein
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    413389 (hem)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     413389 (hem)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   413389 (hem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 764 aa AA seqDB search
MSSTLENKILNLQERLRAENESRDRDRQNSEVGPGTSLQSSSSGSVSSSASRPPIPTLKV
SQIPPKKQDSEFESKLQEIMKMNGILNINGQRYQTEMKDLEHLGELGNGTCGHVVKMRHK
PSGVLIAVKQMRRSGNAEENKRIIMDLDVVLKSHDCPYIVQCLGCFITESDVWICMELMA
TCLDKLLKKTRQAMPEEFLGKVTVATVKALSYLKEKHGVIHRDVKPSNILLDERGGVKLC
DFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGITLVELATGVF
PYRDCKTDFEVLSRVVQDDPPSLPPDASFSKEFRNFVSCCLTKNYKHRPKYHKLMEHPFI
RKYDVPQDEETNSSVLNSSCQWFGRVMQQLEPSFRLPGWQQRITGHVSLKQTAHLRAQSE
VPAFLRSNVTKDSQNSSFLPFHQRSNSENGANYVSYSPYALRRKEISRPFSPPSSNEADI
SETNFQRPYSPYKQHVDQNRDYSSNHCSINGQGRQEGRPFSPYRQDISTIEGNRLYSPYH
GRFTEDRDTSKERWQGVSRSLSPFARDYSPWRRENVDPPNVIQSTESGRYSPFLQQRLGQ
TPSVPQTHPQTQDIYGSPMISRKRFPSEPPPQGSHGSTSPELLISRFAHQLKQEPSSVMP
PVQGGSKESAKKRFASYVRLRLGSERAPSPEPPPRLSRGESPLALRRNLIDQASPSFARR
YVSSSPPQPPPRRLSESNSVPGSPQHVRARLRYTPEPQRRPPPP
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtactctggagaataagatcttaaatttgcaagaacgtcttagagcagaaaat
gaatcaagagatagagatagacagaacagcgaggttggaccaggaacgagccttcaatcg
tcatcttcgggatctgtctcgagttctgcttcacgtcctccaataccaacattgaaagtc
tcacagatacctccaaagaaacaggatagtgaatttgaatcaaaactacaagaaattatg
aaaatgaatggtattttaaatattaatggtcaaaggtatcaaactgaaatgaaagattta
gagcatctaggtgaattgggaaatggtacctgtggtcatgttgtaaaaatgaggcataaa
cctagtggtgtactcattgctgtcaagcaaatgagacgttctggtaatgcagaagaaaat
aaaagaataattatggatcttgatgttgttttaaaatcacatgattgtccatatattgtg
caatgtttgggttgttttattactgaatctgatgtatggatttgtatggaattaatggca
acttgtttagataaattattaaaaaaaactagacaagcaatgccagaagaatttttagga
aaagttacagtagcaacagtaaaagcattatcatatttgaaagaaaagcatggtgtaatt
cacagagatgtaaaacctagtaacatacttcttgatgaaaggggaggagttaaattatgt
gattttggtatatctggtagattagttgatagtaaagcaaaaactagaagtgcaggatgt
gctgcttatatggctcctgaaagaatcgatcctcctgatccaactaaaccagattatgat
ataagagcagatgtttggagtttgggtatcactttagttgaattagctacaggggtattt
ccttacagagattgtaagactgattttgaggtattgagcagagtagtacaagatgatcct
ccctcccttccaccagatgcatcgttttctaaggaatttagaaattttgtgagttgttgc
cttacaaaaaattataaacatcgtccaaaatatcataaactcatggaacatccttttatt
cgaaaatatgatgtaccacaagatgaagaaacaaactcttcagttctaaattctagttgc
caatggtttggcagagttatgcaacaattggaaccaagtttcagattgccagggtggcag
cagcgaatcacgggtcatgtatctctaaaacaaacagctcatctcagggctcaatctgaa
gtaccagctttcctacgaagcaatgtcaccaaagactcacaaaactccagctttttgcca
tttcatcaacgatcaaatagtgagaatggtgcgaactacgtatcttatagtccatacgct
cttagacgaaaggaaatttccaggccattttctcctccttcgtccaatgaggcggatata
tcagaaacgaattttcaacgaccatattcaccatataaacaacatgtcgatcaaaatagg
gattattcttcaaatcattgttctattaatggacaaggtagacaagaaggaagaccgttc
tctccatatcgacaagatattagtacaatagaaggaaatagactttattcaccatatcat
ggacgtttcacggaagatcgagataccagtaaggaaagatggcaaggtgtctctagatct
ttaagtccatttgctcgagattattcaccatggaggagagaaaatgttgaccctccaaat
gtaatacaatcaactgaaagtggacgttattctccatttcttcaacaacgattaggacaa
actccatctgtgcctcaaactcatccacaaacgcaagatatttatggtagtcctatgatt
agtcgtaaaaggtttccttctgagcctcctccacaaggatctcatggttctactagccct
gaattattaatttctcgttttgctcatcaattgaaacaagaaccttcatctgttatgcca
cctgttcagggtggatctaaagaatctgccaagaagcgttttgcttcttatgttcgtctt
agacttggaagtgaacgtgctccttcgccagaaccaccaccaagattaagtcgtggtgaa
tctcctctcgctcttagaaggaatttaatagatcaagcctctccttcttttgcacgaagg
tatgtttcatcttctccgcctcaaccacctccaagaaggttatcggaaagtaattccgta
cctggtagccctcaacatgtacgagctcgattacgttacactcctgaaccgcagaggaga
cctccgcctccataa

DBGET integrated database retrieval system