KEGG   Apis mellifera (honey bee): 413439Help
Entry
413439            CDS       T01057                                 

Gene name
GB12426
Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
ame  Apis mellifera (honey bee)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    413439 (GB12426)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     413439 (GB12426)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 292 aa AA seqDB search
MSNSRKTKTRRDSDSIDFKELNCKRIKLSNENNSETEDNKISNDASLGNISEQILSVERD
LVIELGKIVFHSPIEYVYSPLEYAFNIHTMYVQKYCNTIKKILFLGMNPGPWGMSQTGVP
FGEISMVRDWLKICGPVGKPVKEQPNRKVTGFQCNRSEISGKRLWSLFQKLCGSPEKFFQ
QAYIHNYCPIALMKKNGCNITPAEIKGSEIQTLHSSCDKALLDIIKIIKAEIVIGIGGYA
EKRAQFVIQSSKLPIKVLCLPHPSPRAVNNKNWSEKATKKLSEFGLLERFIS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcaagaaaaaccaaaacaagacgtgatagtgactcgatagattttaaagaa
ttaaattgtaaaagaattaaattatcaaatgaaaataattctgaaacagaggataataaa
atttccaatgacgcatcacttggaaacatatctgaacaaatactatcagtagaacgtgat
ttagtcatagaattaggaaaaattgtattccattcaccaatagaatatgtttatagtcca
cttgaatatgcatttaatatacatactatgtatgtacaaaaatattgtaatactatcaaa
aagatattatttcttggaatgaatcccggtccttggggtatgtctcaaactggtgtgcca
tttggtgagataagcatggttcgtgattggttaaaaatttgtggtcctgtgggaaaacca
gtcaaagaacaaccaaatagaaaagtaacaggatttcaatgcaatcgcagtgagatcagt
gggaaaagattatggagccttttccaaaaattgtgtggaagtccagaaaaattctttcaa
caagcatatatacataattattgtcctattgctttaatgaaaaaaaatggctgcaatatt
acaccagccgagataaagggatcagagatacaaacattacattctagttgtgacaaggct
ttattagatataattaaaatcataaaagctgaaattgtaattggtattggtggatatgca
gaaaagcgagcacaatttgtaattcaatcatcaaaattacctattaaggtattatgttta
cctcatccaagtccacgtgctgtaaataataaaaattggagtgaaaaagcaactaaaaaa
ttaagtgaatttggattacttgaacgttttatatcttag

DBGET integrated database retrieval system