KEGG   Apis mellifera (honey bee): 413645Help
Entry
413645            CDS       T01057                                 

Gene name
SP22, GB13791
Definition
serine protease 22
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ame04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG6
AA seq 259 aa AA seqDB search
MFFNVKDISFFNLLLIFNLSVFITSCLGSKLPLPDTQIVGGTAADISQFPHQLSLQTTGH
ICGASVINSQWAITAAHCVTLSANRYHLRAGSTYKDQGTIYTLKRIIVHPNYNSKTIDYD
IALLQIDGTIQLNSNVQPVKLATSEPKAGTIVIVTGWGALKQGGSTSARLMQVSIPIVDR
AQCQKAYKNYNTITDRMICAGYTQGGKDSCQGDSGGPMVAQGTLYGIVSWGYKCAEPNYP
GVYTNVAHLRSWIKSNSGV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaatgttaaagatatttcttttttcaaccttcttttaatcttcaatcttagc
gttttcattacaagttgcctcggatccaagttacctttaccggatactcaaatcgtggga
gggactgcggctgatataagtcagtttcctcaccaactcagtttacaaactacgggacat
atatgcggcgcttcagttatcaattctcaatgggctatcactgcagctcattgcgtcaca
ttatcagctaatcgataccatctacgagctggtagtacatataaagatcaaggcactatt
tacaccttaaaaagaattattgtacatcctaattacaattctaaaactatcgattacgat
atagctcttctacagattgatggcaccatacaattaaactcgaatgtccaacctgtaaaa
cttgcaacatcggaaccaaaagctggaacaatagtgattgtaactggttggggcgcactt
aagcaaggaggatcaacttcggctcgattgatgcaagtatcgattcctatagtggacaga
gctcaatgccaaaaagcctacaaaaattacaacacaatcacagacagaatgatatgcgcc
ggttacacccaaggtggaaaggattcttgtcaaggggattctggtggccctatggtggct
caagggaccctctatggcatagtatcatggggttacaaatgtgctgagccaaattatcct
ggagtttatacgaacgtggcacatctacgatcttggattaagagtaacagcggagtataa

DBGET integrated database retrieval system