KEGG   Apis mellifera (honey bee): 413672Help
Entry
413672            CDS       T01057                                 

Gene name
GB10904
Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    413672 (GB10904)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     413672 (GB10904)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1
AA seq 582 aa AA seqDB search
MTRLRGRASLMIIIMISFTLLIIIYHILGNEVKDITSNKLSPRLKIEEVYPLSDLTENPL
SIARKQQIEAHIMGKLKSGGGNIFGDFNYGKSRIEVPLFKGHKIVHLDLKGAPPKASYYK
YLLRLLKKLGATGILIEYEDMFPFEGIIQNISAGNCYTKRDITNIQKIANENQLIVIPLI
QTFGHMEFVLKLDKYKDYREVSRYPQVLCPTYNKTLPLIYEMIDQIIEAHPDIKHLHIGA
DEVYQIGECSRCSDVIIKKQWGKKQLFLDHVSKVAKYIKNKYPELTILMWDDEFREISSE
EIIDRGLHLMVEPVVWKYTTDPGVSLTDQLWESYASVWKNIWIATAFKGATAPDRYYTDI
AYHIENHQRWLEIINRYSTQIRFKGAILTGWQRYDHFSVLCELLPSAIPSLAVNLAILQA
PDLCRFPVEVPTPVLQALQCEGIISLNIPEPQYGWTKCNYHGVSIYAATLRLFSLTQEVN
KMEQDNTFKGWLKSYNLKYAFSNPSHVERAIADLDKYKMEIMYIEKEIRSSMENIYDNYT
IQEWIETYIDPLNEKLTQLWEAKEKILEKNIWPRRPLTKSDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgactaagaggcagagcctctttaatgatcattataatgatcagttttactcta
ttgattattatttatcatattctcggtaatgaggtcaaggacattacgtccaataaatta
agtccacgacttaaaatcgaagaagtttatccattgagtgatctcacagagaatcctctt
agtattgccagaaaacaacaaatagaggctcatataatgggaaagttaaaaagtggtgga
ggcaacatattcggtgatttcaattatggtaaatcacgtatagaagttcccttgttcaaa
ggtcataaaattgtacatttggatctaaagggtgcccctccaaaagcaagttattataag
tacctgctacgtttgctcaaaaaattaggtgccactggtatacttatagaatatgaggat
atgtttccttttgaaggaataatacaaaatatcagtgcaggtaattgttataccaagaga
gatattactaacattcaaaaaatagctaatgagaatcaactcatagttataccgttgatt
caaacttttggtcacatggaatttgttctaaaactagataaatataaagattatagagaa
gtttcacgttatccacaagttttatgtcctacatataataaaactcttccattgatatat
gaaatgatagaccaaataatagaagcgcatcctgatataaagcatttacatattggagct
gatgaagtttatcaaataggagaatgttctagatgttcagatgtaataattaaaaaacaa
tggggtaaaaaacaattattcttggatcatgtttcaaaagtagcaaagtatataaaaaat
aaatatccagaacttacaattcttatgtgggatgatgaatttagagaaatatcatctgaa
gaaataatagacagaggtttacatttaatggtagaacctgtcgtttggaaatatactact
gatcctggagtatcattaacagatcaattgtgggaaagctatgcatcagtttggaagaat
atttggattgctacagctttcaaaggtgccactgcaccagatagatattatacagatatt
gcttatcatatagaaaatcatcaacgttggttagaaattattaatagatattctactcag
attagatttaagggtgcaattttaaccgggtggcaaagatatgatcatttcagtgtactt
tgcgaacttttaccatctgccataccctcacttgctgtaaatttagctatcttacaagct
ccagatttatgtagattcccagtagaagtacctactccagtattacaagctttacaatgt
gagggtattatttctttaaatattccagaacctcaatatggttggaccaaatgtaattac
cacggtgtatctatttatgctgccacattgagattgttttctttgactcaagaagtcaat
aaaatggaacaggataatacttttaaaggatggttgaaatcatacaatttaaaatatgca
ttttcaaatcctagtcatgtagaaagagcaattgctgatttggataaatataagatggaa
ataatgtatattgagaaagaaataagatcatctatggaaaatatatatgataattatact
atacaagagtggatagaaacatatattgaccctttaaatgaaaaattaactcaattatgg
gaggctaaagaaaaaattttagaaaagaacatatggccaagaagaccattaacaaaatct
gatttatag

DBGET integrated database retrieval system