KEGG   Apis mellifera (honey bee): 413708Help
Entry
413708            CDS       T01057                                 

Gene name
Pbgs, GB17093
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ame00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 353 aa AA seqDB search
MYKIQFKMNEESYFKNKMAEVEAKHTLHSGIFHPVLRQWQSPNVEITVNTLMYPIFISDE
QDAKEPISSMPGVYRYGINHLRKMLQPLVLKGLQSILLFGVSKHLKKDHIGSNADSIKNP
IIKAVPLIREWFPNLLIACDVCLCPYTIHGHCGILNEDESINNKASIERISEIALAYAKA
GAQIVAPSDMMDGRIGAIKKKLAAAGLMNKVAVLSYAVKFASGFYGPFRDASQSAPKFGD
RKCYQLPPGSNGLAARAAARDVAEGADMLIVKPGLPYLDVVRHTKDAHPEYPMFVYQVSG
EYAMLYHGAQNGAINLENVLKEVLLSMRRAGADCIITYFTPLILDMLQPKSKY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatacaatttaaaatgaatgaagaatcatatttcaagaataaaatggcagaa
gtagaagcaaaacatactcttcatagtggtatttttcatcctgttttacgacaatggcaa
tcgccaaatgtagagattacggttaatactctcatgtatcccatctttatctctgatgaa
caagatgctaaggaaccaatttctagtatgccaggtgtttatcgatatggcattaatcat
ttacgaaaaatgttacaaccattagttttaaaaggattacaatcaatattattatttgga
gtatcaaaacatctaaaaaaggatcatattggaagtaatgcagatagtataaagaatccc
attattaaagctgtaccattaataagggaatggtttccaaatttattaatagcatgtgat
gtatgtttatgtccttatactattcatggtcattgtggaattttaaatgaagatgaaagt
ataaataataaagctagtattgaacgaatttctgaaattgctcttgcatatgcaaaagct
ggagctcaaattgttgcaccatcagatatgatggatggaagaataggtgcaataaaaaaa
aaattagcagcagcaggattaatgaataaagttgcagttttatcttatgcagtgaaattt
gcatcaggattttatggaccttttagagatgcttcacaatctgcacctaaatttggagat
agaaaatgttatcaattacctccaggaagtaatggattagctgctagagcagctgctaga
gatgttgctgaaggagctgatatgcttatagtaaaaccaggattaccttatttggatgtt
gttagacatacaaaagatgcacatccagaatatccaatgtttgtatatcaagtttcagga
gaatatgctatgctttatcatggtgctcaaaatggtgcaataaatttagaaaatgtttta
aaagaagttcttttatcaatgagaagagcaggtgctgattgtattataacatattttaca
ccattaatattagatatgttgcaaccaaaaagcaaatattag

DBGET integrated database retrieval system