KEGG   Apis mellifera (honey bee): 413708Help
Entry
413708            CDS       T01057                                 

Gene name
Pbgs, GB17093
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    413708 (Pbgs)
Enzymes [BR:ame01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     413708 (Pbgs)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   413708 (Pbgs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 353 aa AA seqDB search
MYKIQFKMNEESYFKNKMAEVEAKHTLHSGIFHPVLRQWQSPNVEITVNTLMYPIFISDE
QDAKEPISSMPGVYRYGINHLRKMLQPLVLKGLQSILLFGVSKHLKKDHIGSNADSIKNP
IIKAVPLIREWFPNLLIACDVCLCPYTIHGHCGILNEDESINNKASIERISEIALAYAKA
GAQIVAPSDMMDGRIGAIKKKLAAAGLMNKVAVLSYAVKFASGFYGPFRDASQSAPKFGD
RKCYQLPPGSNGLAARAAARDVAEGADMLIVKPGLPYLDVVRHTKDAHPEYPMFVYQVSG
EYAMLYHGAQNGAINLENVLKEVLLSMRRAGADCIITYFTPLILDMLQPKSKY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatacaatttaaaatgaatgaagaatcatatttcaagaataaaatggcagaa
gtagaagcaaaacatactcttcatagtggtatttttcatcctgttttacgacaatggcaa
tcgccaaatgtagagattacggttaatactctcatgtatcccatctttatctctgatgaa
caagatgctaaggaaccaatttctagtatgccaggtgtttatcgatatggcattaatcat
ttacgaaaaatgttacaaccattagttttaaaaggattacaatcaatattattatttgga
gtatcaaaacatctaaaaaaggatcatattggaagtaatgcagatagtataaagaatccc
attattaaagctgtaccattaataagggaatggtttccaaatttattaatagcatgtgat
gtatgtttatgtccttatactattcatggtcattgtggaattttaaatgaagatgaaagt
ataaataataaagctagtattgaacgaatttctgaaattgctcttgcatatgcaaaagct
ggagctcaaattgttgcaccatcagatatgatggatggaagaataggtgcaataaaaaaa
aaattagcagcagcaggattaatgaataaagttgcagttttatcttatgcagtgaaattt
gcatcaggattttatggaccttttagagatgcttcacaatctgcacctaaatttggagat
agaaaatgttatcaattacctccaggaagtaatggattagctgctagagcagctgctaga
gatgttgctgaaggagctgatatgcttatagtaaaaccaggattaccttatttggatgtt
gttagacatacaaaagatgcacatccagaatatccaatgtttgtatatcaagtttcagga
gaatatgctatgctttatcatggtgctcaaaatggtgcaataaatttagaaaatgtttta
aaagaagttcttttatcaatgagaagagcaggtgctgattgtattataacatattttaca
ccattaatattagatatgttgcaaccaaaaagcaaatattag

DBGET integrated database retrieval system