KEGG   Apis mellifera (honey bee): 413813Help
Entry
413813            CDS       T01057                                 

Gene name
Uch-L3, GB10461
Definition
ubiquitin C-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     413813 (Uch-L3)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   413813 (Uch-L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 311 aa AA seqDB search
MADSAGNWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ
DDEPSGSIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFKNFCQS
FDANMRGLALSNSDVIREVHNSFSRQTIFEYDSKQASKDDDVFHFVSYVPIDGRLYELDG
LKDGPMDLGPCPLGDQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTVYERQIANVC
DPTELERLQTLIEKEIRKSKRYQIENIRRKHNYLPLIMELLKMLAKEGKLVPLYQRAKEK
ALEKESKKNKV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggactcagcgggcaattggtgtcttatcgaaagcgatcctggagtttttacagaa
ttaataaaagaatttggtgttcaaggtgctcaagtggaagaattatggagtttagatgat
gagcaatttgataatttaaagcctatacatggtttgatatttttatttaaatgggtgcaa
gatgatgagccttctggaagtattgttttagataatagattggataagatattttttgca
aaacaggtaattaacaatgcatgtgcaacacaagcaattttgagtgtattattgaattgt
aaacattctgatatatcattgggaccaaatttagaagaatttaaaaatttttgtcaaagc
tttgatgctaatatgagaggacttgctcttagcaattctgatgtgataagagaagtacat
aattctttttcaaggcaaacaatatttgaatatgattcaaaacaagcctctaaagatgat
gatgtatttcattttgtgagctatgttcctatagatggacgattatatgaattagatgga
ttaaaagatggacctatggatttaggcccttgtccacttggagatcaatgggttcaagca
gctaagccaataatacaaaaaagaataaataagtataatgaaggagaaatacattttaat
ttaatggcaatagtaacagatagaaaaacagtttatgaacggcaaatagcaaatgtttgt
gatccaacagaattagaacgtttacaaacattgatagagaaagaaattcgaaaatctaaa
aggtatcagattgaaaatatcagaagaaagcataattatttgccattaataatggaatta
ctcaaaatgcttgctaaagaaggaaaattagtacctttatatcaaagagcaaaagaaaaa
gcattagaaaaggaatcaaaaaaaaataaagtttaa

DBGET integrated database retrieval system