KEGG   Apis mellifera (honey bee): 494523Help
Entry
494523            CDS       T01057                                 

Gene name
Gtpx1, GB14138, Gtpx-1
Definition
glutathione peroxidase-like 1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    494523 (Gtpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    494523 (Gtpx1)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     494523 (Gtpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 168 aa AA seqDB search
MSGNDNYKEAKSIYDFTAKSIKGEDVFLSKYKGHVCLIVNVASKCGLTATNYKELNELYD
EYAESKGLRILAFPCNQFNGQEPGNSEDICNFADRQKVKFDLFEKIDVNGDSAHPLWKYL
KKEQGGILGDFIKWNFTKFIVNKEGKVVERHGPNVAPSNLKNHLEKYF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaacgacaactataaggaagcgaaatcaatttatgatttcactgcgaaatcc
atcaaaggcgaagacgtttttctatctaaatataaaggacatgtttgtttaatcgtaaat
gtagcgtcaaaatgcggccttacagcaacaaattataaagaattgaatgagttatacgat
gaatatgctgaatctaaaggtttacgaattttggcttttccttgtaatcaatttaatggt
caagaaccgggaaatagtgaagatatatgtaattttgctgatcgacaaaaagttaaattc
gacttgtttgaaaaaattgacgttaatggagattctgcgcatcctttatggaaatattta
aaaaaagaacaaggaggaattttgggtgatttcataaaatggaattttacaaaatttatt
gtaaataaagaaggcaaagtggtggaacgccatggtccaaatgtggctcccagtaatttg
aaaaatcatcttgaaaaatatttttaa

DBGET integrated database retrieval system