KEGG   Apis mellifera (honey bee): 550716Help
Entry
550716            CDS       T01057                                 

Gene name
GB19359
Definition
clathrin heavy chain-like
Orthology
K04646  
clathrin heavy chain
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:ame00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    550716 (GB19359)
   04142 Lysosome
    550716 (GB19359)
Exosome [BR:ame04147]
 Exosomal proteins
  Proteins found in most exosomes
   550716 (GB19359)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 1678 aa AA seqDB search
MTQLLPIRFQEHLQLTAVGINANNVSFNTLTMESDKFICVREKVGDTAQVVIIDMNDSAN
PIRRPISADSAIMNPASKVIALKAMKTLQIFNIEMKSKMKAHTMTEDVVFWKWISLNTLA
LVTETAVYHWSMEGESTPNKMFDRHSSLNGCQIINYRTDPKQTWLLLIGISAQHNRVVGA
MQLYSVERKCSQPIEGHAASFAQFKMEGNAEPSNLFCFAVRTVQGAKLHIIEVGQPPAGN
HPFPKKAVDVFFPPEAGNDFPVAMQVSSKYDVIYLITKYGYIHMYDIESATCIFMNRISG
ETIFVTAPHEASGGIIGVNRKGQVLSVSVDEENIIPYINGVLQNSELALRMAVRNNLSGA
EDLFVRKFNLLFQNGQYAEAAKVAANAPKGILRTPATIQRFQQVPTTQGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLVQGRKQLLEKWLKEDKLECSEELGDLVKQADPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVSYTPDYIFLLRNVMRINPDQGVAFAQMLVQDD
EPLADINQIVDIFMEQNMVQQCTAFLLDALKNNRPSEGALQTRLLEMNLMSAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLSPDWLVGFFGTLSV
EDSLECLKAMLTANIRQNLQICIQIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIVN
FSQDQEVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLSDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVRGQF
STDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQFY
DSRVVGKYCEKRDPHLACIAYERGQCDRELISVCNENSLFKSEARYLVRRRDPDLWAEVL
LESNPYKRPLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVLDSSVFSD
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAINNELYEEAFAIFKKFDVNTS
AIQVLIEQVNNLDRAYEFAERCNEPPVWSQLARAQLQQGLVKEAIDSFIKADDPSAYVDV
VETAHRTSHWEDLVRYLQMARKKARESFIESELIYAYARTNRLADLEEFISGPNHADIQK
IGDRCFDDKMYDAAKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFAC
VDSGEFRLAQMCGLHIVVHADELEDLINYYQDRGHFEELINLLEAALGLERAHMGMFTEL
AILYSKYKPQRMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLAMMQ
HPTEAWREGHFKDVITKVANVELYYKAIQFYVEYKPLLLNDILLVLAPRMDHTRAVAYFK
RTGHLQLVKPYLRSVQALNNKAINEALNGLLIDEEDYQGLRTSIDAFDNFDNIALAQQLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDRLFRDAMEYAAESRNPEVAQELLEWFLER
GSKDCFAACLFHCYDLLHPDVILELAWRHRILHFAMPYLIQVAREYITKVDKLEEAESRR
IEETDHQEHKPMIMPEPQLMLTAGPGMMAPGYAPQGVYGAPPQSVYAPTAAAYQAYGM
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagttactacccataaggtttcaagaacatctccagcttacagctgttgggatt
aatgctaacaatgttagctttaatacacttacaatggaatctgataaatttatttgtgtt
cgagaaaaagttggcgatactgcacaagtagttattattgatatgaatgattctgcgaat
cctatcagaagacctatttctgcagattctgcaattatgaatcctgcgagtaaagtaatt
gctttaaaagcaatgaaaactcttcagatttttaatatagaaatgaaatcaaaaatgaaa
gctcatacaatgacagaagatgtagtattctggaaatggatatctttaaatactttggca
ttggtaacagaaactgcagtttatcattggtcaatggaaggagaatcaactccaaataaa
atgtttgaccgacattcttcattaaatggctgtcaaataattaattatagaactgatcca
aaacaaacatggttattattaattggtatttctgctcagcacaatagagtggttggtgct
atgcaactttattctgttgaaagaaaatgttctcaaccaattgaagggcatgctgcttct
tttgcccaatttaaaatggaaggaaatgcagaaccgagtaatttattttgttttgctgtt
aggacagtacaaggtgcaaaactccatattattgaagtaggtcaacctcctgctggtaat
catccttttccaaagaaagcagtagatgtttttttcccaccagaagctggaaatgatttt
cctgttgctatgcaagttagctcaaaatatgatgttatatatttaataacaaaatatgga
tatatacatatgtatgatattgaatctgctacatgtatatttatgaatcgcatatctggc
gaaactatttttgttactgcaccacatgaagcatctggtggtataataggggtaaatcga
aaaggtcaagtattatctgtatctgttgatgaagaaaatataattccatatataaatgga
gtattacaaaattctgaacttgcattacgaatggctgtaagaaataatttgtcaggagct
gaagatttatttgtaaggaaatttaatttactttttcaaaatggtcaatatgcagaagca
gccaaagttgcagcaaatgctccaaaaggaatacttcgaactccagcaactattcaacga
ttccaacaggttccaactacacaaggacaaacatcgcccttgttacaatattttggaata
cttctagatcaagggcaattaaataaatatgaatctttggaattatgtcgtccagtgctt
gtacaaggtcgtaaacaacttcttgaaaaatggttaaaagaagataaattagaatgtagt
gaagaattgggtgatttagtgaaacaagctgatccaactttagctcttagtgtttattta
agagctaacgtccctaataaagttatacaatgttttgcagaaactggtcaattccaaaaa
attgtattgtatgctaagaaagtttcgtatactcctgattatatatttttgttaagaaat
gtcatgagaattaatccagatcaaggtgtagcatttgcccagatgttagttcaagacgat
gaacctttagctgacattaatcaaattgtggatatatttatggaacaaaatatggttcaa
caatgtacagcatttttattagatgctttgaaaaataatcgaccaagtgaaggagcttta
caaacacgacttttagaaatgaatctaatgtctgctccacaagttgctgatgcaatttta
ggaaatcaaatgtttactcattatgatagagcccatattgcacaattatgtgaaaaagct
ggtttattacaacgtgctttggaacattacactgatttgtatgatattaagagagctgta
gtacatacccatttactttctccagattggcttgttggattttttggaacattatcagtt
gaagattctttggaatgtttgaaagcaatgttaactgctaatataagacagaatttacaa
atttgtattcaaatagcaacaaaatatcatgaacagttaactactaaagcattaatagat
ctatttgaaagttttaaatcatacgaaggattgttttattttttgggatctattgttaac
ttcagtcaagatcaagaagtacattttaaatatatccaagcagcttgtaaaactggccaa
attaaagaagttgaacgaatttgtagagaaagtaactgttacaatccggaacgtgtaaaa
aatttccttaaagaagcaaaattatctgatcaattacctttgatcattgtttgtgatcga
ttcgatttcgtacatgatcttgtactatatctctatcgaaataatttacaaaagtacatc
gaaatttatgttcaaaaagtaaatccgtcgcgtctacctgttgtagtcggtggtttattg
gatgtagattgttcagaagatataataaaaaatttaattcttgtggtacgtggccaattc
tctactgatgaacttgtagaggaagttgagaaaagaaatcgtctaaaactcttacttcct
tggctggaatctcgtgttcatgaaggttgcgttgaacctgcaacacataatgcattagca
aaaatatacattgacagtaataataatccagaaaggttccttaaagaaaatcagttttat
gacagtagagtagtaggaaaatattgtgaaaaacgtgatccacatttagcatgtattgca
tatgagcgtggtcagtgcgatcgggaattaataagcgtatgtaacgaaaatagtcttttt
aaaagtgaagctagatatttggtaagacgtagagatccagatttatgggctgaagttctc
ctcgaaagtaatccttataaaagaccgttgatcgatcaggttgtacaaacagctttatca
gaaacacaagatcctgaagatatatcagttactgttaaagcatttatgaccgctgattta
cctaatgaattaattgaacttctcgaaaaaattgtacttgatagcagcgtatttagtgat
catcgtaatttacaaaatcttttaattttgacggcaataaaagctgatcgtacaagagtt
atggaatatataaaccgactggataattatgatgctcctgatattgctaatattgctatc
aataatgaattatatgaagaagcttttgctatctttaaaaaatttgatgtaaatacatct
gctattcaagttttaattgagcaagtgaataatttagatagagcttatgaatttgctgaa
agatgtaatgaaccacctgtatggtctcaattagccagagcacaattacaacaaggttta
gttaaagaagctatagatagttttattaaagcagacgatccatcagcatatgtagatgta
gtagaaactgctcatcgaacttctcattgggaggatttagttcgttatttacaaatggct
cgtaaaaaagcacgtgaatctttcattgaaagtgaattaatttatgcatatgcaagaaca
aatagacttgcagatcttgaagaatttatttctggtcctaatcatgctgatatacaaaag
attggtgatagatgtttcgatgataaaatgtacgatgctgctaaacttttatacaacaat
gtatcgaattttgcacgattagccattacacttgttcacttaaaagaatttcaaggtgcc
gttgatagtgctcgcaaagcaaattcaactcgtacatggaaggaagtttgtttcgcttgt
gtggatagcggagaatttagattagcacaaatgtgtggattgcatatagtcgtacatgct
gatgaattagaagatttaatcaattactatcaagatcgagggcattttgaggaacttatt
aatttgttagaagctgcattagggcttgaaagagcacatatgggaatgtttactgaatta
gctatactttatagcaaatataaacctcaaagaatgagagagcatcttgaacttttttgg
tctcgagttaatataccaaaggtacttcgtgctgcagaacaagcacatttgtgggcagaa
cttgtatttttatatgataaatatgaagaatatgacaatgcagttcttgcaatgatgcaa
catcctactgaggcatggagagaaggtcattttaaagatgtaattactaaagtggcaaat
gttgagctttattacaaagctatacaattttatgttgaatataaacctttacttttgaat
gatatattacttgtacttgctccacgcatggatcatacgagagcagttgcatatttcaaa
agaacaggacatttacaacttgtaaaaccttacttgagatcggttcaagcgttaaacaat
aaagcaattaatgaggcattaaatggtctacttattgatgaagaagattatcaaggactc
agaacatcgattgatgcgttcgataattttgataatattgcactagcacaacaattagaa
aaacatgaattaattgagtttagaagaattgcagcatatttgtacaaaggaaataataga
tggaaacaatcagtagaattgtgtaaaaaagacagattatttagagatgctatggaatat
gcagcagaatctcgcaatcccgaagttgctcaagaattattagaatggtttttagaaaga
ggatcaaaagattgctttgcagcatgtctatttcactgttatgatttacttcatccagat
gttattctagaacttgcatggagacatcgtattttacattttgctatgccatatcttata
caagtagcacgggaatatattactaaggtcgataaactagaagaagctgaaagtcgacgt
atagaagaaactgatcatcaagaacataaacctatgattatgccggaacctcaattaatg
ctgacagcaggaccaggtatgatggcacctggttatgcaccacaaggtgtatatggcgca
ccaccacaaagcgtttatgcaccaactgcagcagcataccaagcttatggtatgtga

DBGET integrated database retrieval system