KEGG   Apis mellifera (honey bee): 551173Help
Entry
551173            CDS       T01057                                 

Gene name
4EHP
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  
translation initiation factor 4E
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    551173 (4EHP)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    551173 (4EHP)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     551173 (4EHP)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     551173 (4EHP)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    551173 (4EHP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 210 aa AA seqDB search
MSNKFEASTCRLKANEDNGDDETQSKDNQKTEKDSLPPIEINPNEHKLQYAYALWYSRRS
PGKQPSIQSYDQNLKLVGRFASVEQFWSLYSHLVRPSELTTSTDFHLFKVGIKPMWEDEA
NQKGGKWIVRLRKGLVSRCWENLILAMLGEQFMVGEEICGAVVSIRFQTASDYATTARIR
DTLRRVLHLPASASMEYKTHNESLKNVHRL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataaatttgaagctagtacttgcaggttaaaggctaatgaagacaatggagat
gatgaaacacagtcaaaagataatcaaaaaactgagaaagattcactacctcctatagaa
attaatccaaatgagcacaaattacaatatgcatatgcattatggtatagtcgacgcagt
cctggtaaacaaccaagtatacaaagttacgaccaaaatttaaaattggttggtaggttt
gcaagtgtggagcagttttggagtctttacagtcatttagtccggccatcagaattaaca
acatctacagattttcatcttttcaaagttggcataaaaccaatgtgggaagatgaggca
aatcaaaaaggtggtaaatggatagtacgattaagaaaaggtttagtttctagatgttgg
gaaaatcttatattagctatgttaggagaacaatttatggttggagaagagatatgtgga
gctgttgtatctataaggtttcaaactgcatctgattatgcaacaacagcacgtattaga
gatacattaaggagagttttacatcttccagcaagtgcctcaatggaatacaaaactcat
aatgaaagtttaaagaatgttcatcggctctaa

DBGET integrated database retrieval system