KEGG   Apis mellifera (honey bee): 551173Help
Entry
551173            CDS       T01057                                 

Gene name
4EHP, GB11528
Definition
4EHP
Orthology
K03259  
translation initiation factor 4E
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    551173 (4EHP)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    551173 (4EHP)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    551173 (4EHP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG4
AA seq 219 aa AA seqDB search
MSNKFEASTCRLKANEDNGDDETQSKDNQKTEKDSLPPIEINPNEHKLQYAYALWYSRRS
PGKQPSIQSYDQNLKLVGRFASVEQFWSLYSHLVRPSELTTSTDFHLFKVGIKPMWEDEA
NQKGGKWIVRLRKGLVSRCWENLILAMLGEQFMVGEEICGAVVSIRFQEDIICVWNKTAS
DYATTARIRDTLRRVLHLPASASMEYKTHNESLKNVHRL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataaatttgaagctagtacttgcaggttaaaggctaatgaagacaatggagat
gatgaaacacagtcaaaagataatcaaaaaactgagaaagattcactacctcctatagaa
attaatccaaatgagcacaaattacaatatgcatatgcattatggtatagtcgacgcagt
cctggtaaacaaccaagtatacaaagttacgaccaaaatttaaaattggttggtaggttt
gcaagtgtggagcagttttggagtctttacagtcatttagtccggccatcagaattaaca
acatctacagattttcatcttttcaaagttggcataaaaccaatgtgggaagatgaggca
aatcaaaaaggtggtaaatggatagtacgattaagaaaaggtttagtttctagatgttgg
gaaaatcttatattagctatgttaggagaacaatttatggttggagaagagatatgtgga
gctgttgtatctataaggtttcaagaggatataatatgtgtatggaataagactgcatct
gattatgcaacaacagcacgtattagagatacattaaggagagttttacatcttccagca
agtgcctcaatggaatacaaaactcataatgaaagtttaaagaatgttcatcggctctaa

DBGET integrated database retrieval system