KEGG   Apis mellifera (honey bee): 551282Help
Entry
551282            CDS       T01057                                 

Gene name
GB14732
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ame  Apis mellifera (honey bee)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    551282 (GB14732)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     551282 (GB14732)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 308 aa AA seqDB search
MSKIVIVGSCMIDFTCFSSRFPKPGETIIGRKFEVKYGGKGANQCIAAARLGATTAIIAS
LGSDNYAQEYLKIFKKENVDASHVQIQTNIHSGISHITVIDSGENSIITVLGSNNLLSRN
HIDNSINLIKNASVLLCQFEIPLEITLHALKLHKNYGLSIVNGAPAMKNIDVELLKLCDI
FCVNELEAEVTSGISFDGKLSIEHIMNKLLDMGCNTVIITLGKQGAIYASQKDRTVKKVL
TATVQPMDTTGAGDSFLGALAYFKAYHPTLSMDECIRRSCIIATKSVLKFGTHASFPHKR
DLSPDLFI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattgttattgttggctcatgcatgattgattttacttgcttttcctctcgt
tttccaaaacctggggaaacaataattggtagaaaatttgaggtaaaatatggtggtaaa
ggtgctaatcaatgtatagcagctgccaggcttggtgcaaccacagcaatcattgcttct
ttaggttctgataattatgctcaagaatacttaaagatttttaagaaggaaaacgtagat
gcttctcacgttcaaatacaaacaaatatacatagcggaatatcacatataacagttatc
gacagtggcgaaaacagtatcataactgtattaggatccaataatttattaagtcgcaat
catatagataactcgataaatttaatcaagaatgcttccgttttattgtgtcaatttgaa
atacctttggaaattactttacacgccttgaagcttcacaaaaattatggtctatcaatt
gtaaatggagcacctgctatgaaaaatattgacgtggaattgttgaaactctgtgatata
ttctgcgttaatgaactcgaggcagaagttacgagtgggatatccttcgacggaaaattg
agtatagaacatattatgaataaattgttggatatgggttgcaatacagttattattact
cttggtaaacaaggagcaatatatgcatctcagaaggatagaactgttaaaaaagtcttg
actgctactgttcaacctatggatacaacaggagctggagattcatttctaggagctctt
gcatattttaaagcttatcatccaacactttcaatggacgagtgtatccgaagatcttgt
atcattgctacaaaatccgtattaaaatttggtacacatgcaagttttccgcacaagaga
gatttatcgccagatttgttcatttaa

DBGET integrated database retrieval system